ESTScan Details for Unigene SGN-U335748

Score 
9
Direction 
Forward
Predicted Peptide Sequence 
LAVFLQRPDWENPGVTQLNRLEEHPPFASWRNSKEARTDRPSKHLRXPEWQMANCKR
Predicted Coding Sequence 
CTGGCCGTGTTTTTACAACGTCCTGACTGGGAAAACCCTGGCGTTACCCAACTTAATCGCCTTGAAGAACATCCCCCTTTCGCCAGCTGG
CGTAATAGCAAAGAGGCCCGCACCGATCGCCCTTCCAAACATTTGCGCATXCCTGAATGGCAAATGGCAAATTGTAAGCGTTAA
Edits in Original Sequence 
AAATCCTGGTTTCCTTTGGGGTCTTGGATTTTTTACTATTGATGTTCTAAGAGGTACCGATAGAAGCATGAAAATTGAATATCAGGCTTA
CGTTACAGTTAAACCTGAGTTTTATTATATCGTGTATGTTTAATGTAATTCTAGTTTTGCTCTTATC
(5')CTGGCCGTGTTTTTACAAC
GTCCTGACTGGGAAAACCCTGGCGTTACCCAACTTAATCGCCTTGAAGAACATCCCCCTTTCGCCAGCTGGCGTAATAGCAAAGAGGCCC
GCACCGATCGCCCTTCCAAACATTTGCGCATXCCTGAATGGCAAATGGCAAATTGTAAGCGTTAA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan