ESTScan Details for Unigene SGN-U335757

Score 
5
Direction 
Forward
Predicted Peptide Sequence 
VEIDLTPLGGARSRTSGSPGLQEFGTSLVLDGFDEIALYVVPFSSXRTYLPAGLILWVNETYPSVPLFXDVTFAATDSETHYLCPSIRCM
TLMCGTVDCTLNNNMLRGGALLILDEDGINFASWEEYSIEGPFDPFECRGSPSGSYMEEFRSRTPAVRYDSLCSNDPTQEWWYVWQSSNM
TRR
Predicted Coding Sequence 
GTTGAAATCGATTTGACTCCCTTGGGAGGCGCCCGCTCTAGAACTAGTGGATCCCCCGGGCTGCAGGAATTCGGCACCAGCCTTGTGCTA
GATGGGTTTGATGAGATAGCACTTTATGTTGTTCCATTTTCTTCTXATAGGACGTACCTTCCAGCTGGGTTAATTCTTTGGGTGAATGAA
ACCTATCCTTCTGTTCCATTATTTAXAGATGTTACATTTGCTGCTACTGATTCAGAGACTCATTATCTTTGCCCTTCCATCAGGTGCATG
ACACTAATGTGTGGTACGGTTGATTGTACTTTAAACAATAATATGCTTCGGGGAGGGGCACTTCTXATCCTTGATGAGGATGGCATCAAC
TTTGCATCATGGGAAGAATATTCTATTGAAGGCCCTTTTGACCCATTTGAGTGTCGTGGGAGCCCCTCGGGATCATACATGGAGGAGTTC
CGAAGCAGAACCCCTGCTGTTCGATACGATTCATTGTGTTCTAATGACCCTACACAAGAATGGTGGTATGTCTGGCAGAGTTCAAACATG
ACCAGGAGATAA
Edits in Original Sequence 
(5')GTTGAAATCGATTTGACTCCCTTGGGAGGCGCCCGCTCTAGAACTAGTGGATCCCCCGGGCTGCAGGAATTCGGCACCAGCCTTGT
GCTAgGATGGGTTTGATGAGATAGCACTTTATGTTGTTCCATTTTCTTCTXATAGGACGTACCTTCCAGCTGGGTTAATTCTTTGGGTGA
ATGAAACCTATCCTTCTGTTCCATTATTTAXAGATGTTACATTTGCTGCTACTGATTCAGAGACTCATTATCTTTGCCCTTCCATCAGGT
GCATGACACTAATGTGTGGTACGGTTGATTGTACTTTAAACAtATAATATGCTTCGGGGAGGGGCACTTCTXATCCTTGATGAGGATGGC
ATCAACTTTGCATCATGGGAAGAATATTCTATTGAAGGCCCTTTTGACCCATTTGAGTGTCGTGGGAGCCCCTCGGGATCATACATGGAG
GAGTTCCGAAGCAGAACCCCTGCTGTTCGATACGATTCATTGTGTTCTAATGACCCTACACAAGAATGcGTGGTATGTCTGGCAGAGTTC
AAACATGACCAGGAGATAA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan