ESTScan Details for Unigene SGN-U335865

Score 
120
Direction 
Reverse
Predicted Peptide Sequence 
PSGFHLSEETGKEPPNFAKPPFPGGLGRFINAXWPDRFFPTERGAVSATQLMELAHSLGPXQALHFMLPARMLCGIVTDNNFTQETAMTM
ITPSSKLTLTKGNKSWSSTAVAAALELVDPRAAGIRHEAQSIEAALENAGLPXVQNRLAAPPPGKSKILDAVATRLEVPPEHVISNLANY
GNTSAASIPLALDEAVRSGKVQAGHVIAAAGFGAGLTWGSANTQMGLNAAVKFGSGLTSGFCSNQIGKKPLKASTYE
Predicted Coding Sequence 
CCCAGCGGATTTCATTTAAGCGAGGAAACCGGAAAGGAGCCCCCCAATTTCGCAAAACCGCCTTTCCCCGGGGGGTTGGGCCGATTCATT
AATGCAGXTTGGCCCGACAGGTTTTTCCCGACTGAAAGGGGGGCAGTGAGCGCAACGCAATTAATGGAGTTAGCTCACTCATTAGGCCCC
XCCCAGGCTTTACACTTTATGCTTCCGGCTCGTATGTTGTGTGGAATTGTGACGGATAACAATTTCACACAGGAAACAGCTATGACCATG
ATTACGCCAAGCTCGAAATTAACCCTCACTAAAGGGAACAAAAGCTGGAGCTCCACCGCGGTGGCGGCCGCTCTAGAACTAGTGGATCCC
CGGGCTGCAGGAATTCGGCACGAGGCACAATCAATAGAAGCAGCTTTAGAGAATGCAGGTCTTCCTAGXGTCCAAAATCGATTGGCTGCT
CCTCCACCAGGCAAATCAAAGATTCTTGACGCAGTAGCAACACGTTTGGAGGTGCCACCAGAACATGTCATATCAAATTTGGCAAATTAT
GGCAATACGAGTGCTGCATCGATACCCTTGGCACTGGATGAAGCTGTTCGAAGTGGGAAAGTGCAGGCAGGTCATGTCATTGCTGCTGCT
GGATTTGGTGCTGGCCTTACGTGGGGCTCTGCXAATACTCAGATGGGGCTAAATGCTGCTGTGAAGTTTGGGTCTGGTCTCACATCTGGA
TTTTGCAGTAATCAAATAGGGAAGAAACCTCTCAAAGCCTCAACATATGAATAG
Edits in Original Sequence 
(5')CCCAGCGGATTTCATTTAAGCGAGGAAACCGGAAAGGAGCCCCCCAATTTCGCAAAACCGCCTTTCCCCGGGGGGTTGGGCCGATT
CATTAATGCAGXTTGGCCCGACAGGTTTTTCCCGACTGAAAGGGGGGCAGTGAGCGCAACGCAATTAATGtGAGTTAGCTCACTCATTAG
GCCCCXCCCAGGCTTTACACTTTATGCTTCCGGCTCGTATGTTGTGTGGAATTGTGAgCGGATAACAATTTCACACAGGAAACAGCTATG
ACCATGATTACGCCAAGCTCGAAATTAACCCTCACTAAAGGGAACAAAAGCTGGAGCTCCACCGCGGTGGCGGCCGCTCTAGAACTAGTG
GATcCCCCGGGCTGCAGGAATTCGGCACGAGGCACAATCAATAGAAGCAGCTTTAGAGAATGCAGGTCTTCCTAGXGTCCAAAATCGATT
GGCTGCTCCTCCACCAGGCAAATCAAAGaATTCTTGACGCAGTAGCAACACGTTTGGAGGTGCCACCAGAACATGTCATATCAAATTTGG
CAAATTATGGCAATACGAGTGCTGCATCGATACCCTTGGCACTGGATGAAGCTGTTCGAAGTGGGAAAGTGCAGGCAGGTCATGTCATTG
CTGCTGCTGGATTTGGTGCTGGCCTTACGTGGGGCTCTGCXAATACTCAGATGGGGCTAAATGCTGCTGTGAAGTTTGGGTCTGGTCTCA
CATCTGGATTTTGCAGTAATCAAATAGGGAAGAAACCTCTCAAAGCCTCAACATATGAATAG(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan