ESTScan Details for Unigene SGN-U335919

Score 
94
Direction 
Forward
Predicted Peptide Sequence 
MGSFMYIAILLAAKSQPSIPARHXDRAALLSFRAALNESHLGIFNSWKGNDCCHEWYGVSFPPWDYPEGLPFCGGP
Predicted Coding Sequence 
ATGGGCAGCTTCATGTACATTGCCATCCTACTTGCTGCCAAATCTCAACCGTCCATTCCTGCCCGCCATCAXGATCGGGCAGCATTATTA
TCATTCCGAGCTGCCCTAAATGAATCTCACTTGGGTATTTTCAACTCATGGAAAGGCAACGACTGTTGCCATGAGTGGTACGGGGTGAGC
TTCCCTCCCTGGGATTACCCCGAAGGGTTACCCTTCTGCGGGGGCCCCTAA
Edits in Original Sequence 
GGAAAAACTAAATTCTAAGAGAGAGAAACAAAGACAAACCGGGCTCATGATGGGCAGCTTCATGTACATTGCCATCCTACTTGCTGCCAT
AATCTCAACCGTCCATTCCTGCCCGCCATCAGATCGGGCAGCATTATTATCATTCCGAGCTGCCCTAAA
(5')ATGGGCAGCTTCATGTA
CATTGCCATCCTACTTGCTGCCAtAATCTCAACCGTCCATTCCTGCCCGCCATCAXGATCGGGCAGCATTATTATCATTCCGAGCTGCCC
TAAATGAATCTCACTTGGGTATTTTCAACTCATGGAAAGGCAACGACTGTTGCCATGAGTGGTACGGGGTGAGCTTCCCTCCCTGGGATT
ACCCCGAAGGGTTACCCTTCTGCGGGGGCCCCTAA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan