ESTScan Details for Unigene SGN-U335930

Score 
115
Direction 
Reverse
Predicted Peptide Sequence 
AKIRISALPETGNGKILPRGGRLCYRSGRSEARRLHPDIDIIKVSKGGEFNGAYTRGQGSGSYSVRPIQSSLQTVVGGPPSTGQHFSERL
MHEPESAMGXGEIGHIKRYCPKQSYRPPKVRGRGGHGRVRYSGGRGGEEMVVTKTAEVMGKLEPLHHNMVGATDIRMIGPIVTAFPGRSE
AEESDVVITGNLLVCDCMASVLFDPGSTFSYVSSSFANGLTLHCELLDMPIRVSLQPGGSTSSRAAATAVELQLFVSX
Predicted Coding Sequence 
XXGGCAAAAATTCGGATTTCGGCCTTACCAGAAACCGGCAACGGCAAAATCCTTCCAAGAGGTGGTAGACTTTGTTATAGAAGTGGAAGG
AGTGAAGCCAGACGACTTCACCCCGACATCGACATCATAAAGGTTTCAAAGGGAGGTGAGTTTAATGGTGCTTACACTAGAGGACAGGGT
TCGGGAAGTTACTCAGTCCGACCAATTCAGTCTTCACTACAGACTGTAGTTGGGGGTCCACCTTCGACCGGTCAACACTTCTCTGAGAGA
CTTATGCATGAACCAGAGAGTGCTATGGGTGXTGGGGAGATTGGACATATTAAGAGATATTGTCCAAAACAGAGTTACAGACCTCCAAAG
GTTAGAGGTAGAGGTGGTCATGGCAGAGTCCGTTATTCTGGAGGACGTGGCGGTGAGGAAATGGTGGTCACCAAAACGGCCGAGGTGATG
GGCAAACTGGAGCCACTACATCACAACATGGTAGGGGCAACAGACATAAGAATGATAGGGCCCATTGTTACXGCTTTCCCTGGGCGGTCT
GAAGCGGAGGAATCTGATGTTGTCATCACAGGTAATCTTTTGGTTTGTGATTGCATGGCTTCTGTATTGTTTGATCCTGGATCCACATTT
TCTTATGTATCTTCCTCATTTGCTAATGGTCTAACTTTACATTGTGAATTACTTGATATGCCTATTCGTGTTTCCCTGCAGCCCGGGGGA
TCCACTAGTTCTAGAGCGGCCGCCACCGCGGTGGAGCTCCAGCTATTTGTTTCAANX
Edits in Original Sequence 
(5')XXGGCAAAAATTCGGATTTCGGCCTTACCAGAAACCGGCAACGGCAAAATCCTTCCAAGAGGTGGTAGACTTTGTTATAGAAGTGG
AAGGAGTGAAGCCAGACGACTTCACCCCGACATCGACATCATAAAGGTTTCgAAAGGGAGGTGAGTTTAATGGTGCTTACACTAGAGGAC
AGGGTTCGGGAAGTTACTCAGTCCGACCAATTCAGTCTTCACTACAGACTGTAGTTGGGGGTCCACCTTCGACCGGTCAACACTTCTCTG
AGAGACTTATGCATGAAcCCAGAGAGTGCTATGGGTGXTGGGGAGATTGGACATATTAAGAGATATTGTCCAAAACAGAGTTACAGACCT
CCAAAGGTTAGAGGTAGAGGTGGTCATGGCAGAGTCCGTTATTCTGGAGGACGTGGCGGTcGAGGAAATGGTGGTCACCAAAACGGCCGA
GGTGATGGGCAAACTGGAGCCACTACATCACAACATGGTAGGGGCAACAGACATAAGAATGATAGGGCCCATTGTTACXGCTTTCCCTGG
GCGGTCTGAAGCGGAGGAATCTGATGTTGTCATCACAGGTAATCTTTTGGTTTGTGATTGCATGGCTTCTGTATTGTTTGATCCTGGATC
CACATTTTCTTATGTATCTTCCTCATTTGCTAATGGTCTAACTTTACATTGTGAATTACTTGATATGCCTATTCGTGTTTCCCTGCAGCC
CGGGGGATCCACTAGTTCTAGAGCGGCCGCCACCGCGGTGGAGCTCCAGCTATTTGTTTCAANX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan