ESTScan Details for Unigene SGN-U335933

Score 
98
Direction 
Reverse
Predicted Peptide Sequence 
HPNIDIKKASKGGEFNGSYTRGQGSGSYSVRPIESSLQTVVGGPPQTGQHFSEGPRIDPENGMDVGRLDILGKIVPDKVIDXPIARGRGG
HGRGRYSGGRGGRGNGGHQNGRGNGQTWATTSQHGRGNGQTNDRAHCYAFPGRCEAEASDVVITGNLLVCDCMASVLFDPGSTFSYVSSL
FAFFSSGYKMFQFARLSLALPMDSAAVRKVALFGNLRIYAYFQLPEAFRRLLRPSSSLGAWYPPPAARGIH
Predicted Coding Sequence 
XTTCACCCCAACATCGACATCAAAAAGGCTTCAAAGGGAGGTGAGTTTAATGGTTCTTACACTAGAGGACAGGGTTCGGGAAGTTACTCA
GTCCGACCAATTGAGTCTTCACTACAGACTGTAGTTGGGGGACCACCTCAGACCGGTCAACACTTCTCCGAGGGGCCTAGGATTGATCCA
GAGAATGGTATGGATGTGGGGAGATTGGACATATTAGGAAAAATTGTCCCAGACAAAGTTATAGACXCCCCAATAGCTAGAGGTAGAGGT
GGTCATGGTAGAGGCCGTTATTCTGGAGGACGTGGTGGTCGAGGTAATGGTGGTCACCAAAACGGCAGAGGTAATGGGCAAACTTGGGCC
ACTACATCACAACATGGTAGGGGCAACGGACAGACGAACGATAGGGCCCATTGTTACGCTTTCCCTGGGCGGTGTGAAGCGGAGGCATCT
GATGTTGTCATCACAGGTAATCTTCTGGTTTGTGATTGCATGGCTTCTGTATTGTTTGATCCTGGATCCACGTTTTCTTATGTATCTTCC
TTATTTGCTTTCTTTTCCTCTGGCTACAAGATGTTTCAGTTCGCCAGGTTGTCTCTTGCXCTGCCCATGGATTCAGCAGCAGTTCGAAAG
GTTGCCCTATTCGGGAATCTCCGGATCTATGCTTATTTTCAACTCCCCGAAGCATTTCGTCGATTACTACGCCCTTCCTCGTCTCTGGGT
GCCTGGTATCCACCGCCTGCAGCCCGGGGGATCCACTAG
Edits in Original Sequence 
(5')XTTCACCCCAACATCGACATCAAAAAGGCTTCgAAAGGGAGGTGAGTTTAATGGTTCTTACACTAGAGGACAGGGTTCGGGAAGTT
ACTCAGTCCGACCAATTGAGTCTTCACTACAGACTGTAGTTGGGGGACCACCTCAGACCGGTCAACACTTCTCCGAGGGGCCTAGGATTG
AcTCCAGAGAATGGTATGGATGTGGGGAGATTGGACATATTAGGAAAAATTGTCCCAGACAAAGTTATAGACXCCCCAATAGCTAGAGGT
AGAGGTGGTCATGGTAGAGGCCGTTATTCTGGAGGACGTGGTGGTCGAGGTAATGGTGGTCACCAAAACGGCAGAGGTAATGGGCAAACT
TGGGCCACTACATCACAACATGGTAGGGGCAACGGACAGACGAACGATAGGGCCCATTGTTACGCTTTCCCTGGGCGGTGTGAAGCGGAG
GCATCTGATGTTGTCATCACAGGTAATCTTCTGGTTTGTGATTGCATGGCTTCTGTATTGTTTGATCCTGGATCCACGTTTTCTTATGTA
TCTTCCTTATTTGCTTTCTTTTCCTCTGGCTACtAAGATGTTTCAGTTCGCCAGGTTGTCTCTTGCXCTGCCCATGGATTCAGCAGCAGT
TCGAAAGGTTGCCCTATTCGGGAATCTCCGGATCTATGCTTATTTTCAACTCCCCGAAGCATTTCGTCGATTACTACGCCCTTCCTCGTC
TCTGGGTGCCTaGGTATCCACCGCCTGCAGCCCGGGGGATCCACTAG(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan