ESTScan Details for Unigene SGN-U335939

Score 
67
Direction 
Reverse
Predicted Peptide Sequence 
GHLRRSHSLRADADPEMFGVRDGHLRAVPNRVQTPMAREEVNGRVVFLRACXRVNAVTKTAEVMGKWSHYYTXCRGTDQTNNGALVMLSW
GGXEAEASDAVITGNLLVCDCMASVLFDPGSTFSYVSSSFANGLKLHCELLDMPIRVSTPVGESVIVEKVHRSCLVNFVGSNTYLDLVTL
EMGDFDVILGMTWLSPNFAILDCNAKTVTLAKPGTDPLVWEGDYTSNPVRIISFLCAQKMVSKGCLSFLAHLKDDTIQVPSIELVLVV
Predicted Coding Sequence 
XGGGGTCACCTCAGACGGTCACACTCTCTGAGAGCCGATGCGGACCCCGAGATGTTTGGTGTGAGAGATGGACACTTAAGAGCTGTCCCA
AACAGAGTACAGACCCCAATGGCTAGAGAAGAGGTGAATGGTAGAGTCGTATTTCTGAGGGCGTGTGNCCGAGTAAATGCXGTCACCAAA
ACGGCAGAGGTGATGGGCAAATGGAGCCACTACTACACANCATGTAGGGGCACGGACCAGACAAATAATGGGGCCCTTGTTATGCTTTCC
TGGGGAGGTXCTGAAGCAGAGGCGTCTGATGCTGTTATCACAGGTAATCTCTTGGTTTGTGATTGCATGGCATCTGTATTATTTGACCCT
GGCTCCACGTTTTCATATGTATCTTCATCATTTGCTAATGGTCTAAAATTGCATTGTGAATTACTTGACATGCCTATTCGTGTTTCTACT
CCGGTGGGTGAGTCTGTGATAGTTGAAAAGGTACATAGGTCTTGTTTGGTGAATTTCGTGGGGAGCAACACTTATCTAGATTTGGTTACT
TTAGAAATGGGTGACTTTGATGTAATTCTGGGTATGACTTGGCTTTCTCCCAATTTTGCGATCTTGGATTGTAATGCTAAAACGGTGACG
TTAGCCAAGCCTGGGACAGATCCGTTAGTGTGGGAGGGTGACTACACTTCCAATCCGGTGCGTATTATCTCCTTTCTTTGTGCTCAGAAG
ATGGTTAGTAAGGGTTGTCTATCCTTCTTGGCACATCTCAAGGATGACACTATCCAAGTACCCTCAATTGAATTAGTTTTGGTAGTTTGA
Edits in Original Sequence 
(5')XGGGGTCACCTCAGACGGTCACACTCTCTGAGAGCCGATGCGGACCCCGAGATGTTaTGGTGTGAGAGATGGACACTTAAGAGtCT
GTCCCAAACAGAGTACAGACCCCAATGGCTAGAGAAGAGGTGtAATGGTAGAGTCGTATTTCTGAGGGCGTGTGNCCGAGTAAATGCXGT
CACCAAAACGGCAGAGGTGATGGGCAAATGGAGCCACTACTACACANCATGTAGGGGCACGGACCAGACAAATAATGGGGCCCTTGTTAT
GCTTTCCTGGGGAGGTXCTGAAGCAGAGGCGTCTGATGCTGTTATCACAGGTAATCTCTTGGTTTGTGATTGCATGGCATCTGTATTATT
TGACCCTGGCTCCACGTTTTCATATGTATCTTCATCATTTGCTAATGGTCTAAAATTGCATTGTGAATTACTTGACATGCCTATTCGTGT
TTCTACTCCGGTGGGTGAGTCTGTGATAGTTGAAAAGGTACATAGGTCTTGTTTGGTGAATTTCGTGGGGAGCAACACTTATCTAGATTT
GGTTACTTTAGAAATGGGTGACTTTGATGTAATTCTGGGTATGACTTGGCTTTCTCCCAATTTTGCGATCTTGGATTGTAATGCTAAAAC
GGTGACGTTAGCCAAGCCTGGGACAGATCCGTTAGTGTGGGAGGGTGACTACACTTCCAATCCGGTGCGTATTATCTCCTTTCTTTGTGC
TCAGAAGATGGTTAGTAAGGGTTGTCTATCCTTCTTGGCACATCTCAAGGATGACACTATCCAAGTACCCTCAATTGAATTAGTTTTGGT
AGTTTGA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan