ESTScan Details for Unigene SGN-U335948

Score 
517
Direction 
Forward
Predicted Peptide Sequence 
MEXLESGGFPLTEXPVLCVLLMTDICNAPVASAGNTSTSVRARKEKRLTYVLNDAHDTKHCAGVNCLALLKSSSPGGSEYLFTGSRDGTL
KRWALAEDGATCCATFESHIDWVNDTVLTGNNTLVPAPQTPLSRYGMAYLRDLVPGXLGQHSDYVTCLASAEKNSNVVASAGLGGEVYIW
DLEGALSPTSKSSDATAENCSNGVSGAGSSVSITSVHPNSSSNTISLHTKSQGYIPVSAKGHKESVYALAMNDSGSLLVSGGTEKVXVSF
LSFKCTVLILPKELEQYYFLSFFKVVRVWDPRTGSKDHKAKRAYRIILXALLPESTGKYAGKNDALKNIFGLDAIGYPPK
Predicted Coding Sequence 
ATGGAATTXTTAGAAAGTGGAGGATTTCCGCTGACTGAAAXTCCGGTGCTCTGTGTACTTTTGATGACGGATATCTGCAATGCACCTGTA
GCTAGTGCAGGCAACACATCCACTTCTGTGCGGGCTCGGAAAGAGAAGAGGTTGACCTATGTCTTAAATGACGCTCATGACACTAAGCAT
TGTGCTGGTGTAAATTGCTTGGCTTTGTTGAAGTCGTCCTCACCTGGTGGGTCTGAGTACCTATTTACCGGGAGTAGAGATGGGACTTTA
AAGAGATGGGCATTGGCTGAAGATGGTGCCACCTGCTGTGCTACATTTGAATCCCATATTGATTGGGTAAATGACACTGTTCTTACAGGC
AATAACACATTGGTTCCTGCTCCTCAGACACCACTGTCAAGGTATGGAATGGCTTATCTGAGGGATCTTGTACCAGGAXCTCTTGGTCAA
CACTCTGATTATGTCACTTGCCTTGCTTCAGCAGAAAAAAATAGCAATGTTGTTGCATCTGCTGGCCTTGGTGGTGAGGTTTACATATGG
GACCTTGAAGGTGCACTTTCCCCAACATCTAAGTCAAGTGATGCAACTGCGGAAAACTGTTCAAATGGTGTCAGTGGTGCAGGAAGTTCA
GTATCCATTACAAGCGTCCACCCTAATAGTTCGAGCAACACCATTTCCTTGCACACCAAGTCCCAAGGATATATTCCTGTGTCTGCGAAA
GGCCATAAGGAGTCAGTATATGCATTGGCAATGAATGACAGTGGATCCCTTCTTGTTTCTGGTGGAACTGAGAAGGTATTNGTTAGTTTT
TTATCTTTCAAATGTACTGTTCTTATATTACCAAAGGAGTTGGAACAATACTACTTTCTGAGTTTCTTTAAGGTTGTGCGAGTGTGGGAT
CCAAGAACTGGTTCCAAAGACCATAAAGCTAAAAGGGCATACAGAATTATATTAGXGGCGCTACTTCCTGAATCTACTGGCAAGTATGCT
GGGAAAAATGATGCCCTTAAAAATATTTTTGGCCTCGATGCCATTGGTTATCCCCCTAAA
Edits in Original Sequence 
GAGATAAATGGAATTTTAGAAAGTGGAGGATTTCCGCTGACTGAAATCCGGTGCTCTGTGTACTTTTGATG(5')ATGGAATTXTTAGAA
AGTGGAGGATTTCCGCTGACTGAAAXTCCGGTGCTCTGTGTACTTTTGATGACGGATATCTGCAATGCACCgTGTAGCTAGTGCAGGCAA
CACATCCACTTCTGTGCGGGCTCGGAAAGAGAAGAGGTTGACCTATGTCTTAAATGACGCTCATGACACTAAGCATTGTGCTGGTGTAAA
TTGCTTGGCTTTGTTGAAGTCGTCCTCACCTGGTGGGTCTGAGTACCTATTTACCGGGAGTAGAGATGGGACTTTAAAGAGATGGGCATT
GGCTGAAGATGGTGCCACCTGCTGTGCTACATTTGAATCCCATATTGATTGGGTAAATGACACTGTTCTTACAGGCAATAACACATTGGt
TTCCTGCTCCTCAGACACCACTGTCAAGGTATGGAATGGCTTATCTGAGGGATCTTGTACCAGGAXCTCTTGGTCAACACTCTGATTATG
TCACTTGCCTTGCTTCAGCAGAAAAAAATAGCAATGTTGTTGCATCTGCTGGCCTTGGTGGTGAGGTTTACATATGGGACCTTGAAGGTG
CACTTTCCCCAACATCTAAGTCAAGTGATGCAACTGCGGAAAACTGTTCAAATGGTGTCAGTGGTGCAGGAAGTTCAGTATCCATTACAA
GCGTCCACCCTAATAGTTCGAGCAACACCATTTCCTTGCACACCAAGTCCCAAGGATATATTCCTGTGTCTGCGAAAGGCCATAAGGAGT
CAGTATATGCATTGGCAATGAATGACAGTGGATCCCTTCTTGTTTCTGGTGGAACTGAGAAGGTATTaNGTTAGTTTTTTATCTTTCAAA
TGTACTGTTCTTATATTACCAAAGGAGTTGGAACAATaACTACTTTCTGAGTTTCTTTAAGGTTGTGCGAGTGTGGGATCCAAGAACTGG
TTCCAAAGACCATAAAGCTAAAAGGGCATACAGAATTATATTAGXGGCGCTACTTCCTGAATCTACTGGCAAGTATGCtTGGGAAAAATG
ATGCCCTTAAAAATATTTTTGGCCTCGaATGCCATTGGTTATCCCCCTAAA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan