ESTScan Details for Unigene SGN-U335954

Score 
278
Direction 
Forward
Predicted Peptide Sequence 
GXEELKQGLADXMSLGGMDYADPKKKSNFVGKILMAAVLTALCILMLKQSPTFNTPSAFSRHQPGVVHVLVTGGAGYIGSHAALRLLKEN
YRVTIVDNLSRGNMGAVRILQELFPEPGRLQFIYADLGDAKVVHP
Predicted Coding Sequence 
NNGGGGNGGGAAGAGCTCAAACAAGGTCTAGCAGATXCTATGTCTCTAGGAGGCATGGATTATGCAGACCCAAAGAAGAAGAGCAATTTT
GTGGGTAAAATTCTTATGGCTGCTGTGCTAACAGCGCTATGCATTCTTATGCTCAAGCAGTCTCCAACTTTTAATACCCCAAGTGCATTC
TCTCGCCATCAACCAGGTGTTGTTCATGTCTTAGTCACCGGAGGTGCTGGCTACATTGGTTCCCATGCAGCATTACGACTTTTAAAAGAA
AATTACCGGGTGACGATAGTGGACAACCTTTCACGAGGAAATATGGGAGCTGTGAGGATTCTGCAGGAATTATTTCCTGAACCAGGGAGG
CTTCAGTTTATATATGCTGACTTGGGGGATGCAAAAGTGGTCCACCCX
Edits in Original Sequence 
AAGAGCTCAAACAAGGTCTAGCAGATCTATGTCTCTAGGAGGCATGGATTATGCAGACCCAAAGAAGAAGAGCAATTTTGTGGGTAAAAT
TCTTATGGCTGCTGTGCTAACAGCGCTATGCATTCTTATGCTCAAGCAGTCTCCAACTTTTAATACCCCAAGTGCATTCTCTCGCCATCA
ACCAGGTGTTGTTCATGTCTTAGTCACCGGAGGTGCTGGCTACATTGGTTCCCATGCAGCATTACGACTTTTAAAAGAAAATTACCGGGT
GACGATAGTGGACAACCTTTCACGA
(5')NNGGGGNGGGAAGAGCTCAAACAAGGTCTAGCAGATXCTATGTCTCTAGGAGGCATGGATT
ATGCAGACCCAAAGAAGAAGAGCAATTTTGTGGGTAAAATTCTTATGGCTGCTGTGCTAACAGCGCTATGCATTCTTATGCTCAAGCAGT
CTCCAACTTTTAATACCCCAAGTGCATTCTCTCGCCATCAACCAGGTGTTGTTCATGTCTTAGTCACCGGAGGTGCTGGCTACATTGGTT
CCCATGCAGCATTACGACTTTTAAAAGAAAATTACCGGGTGACGATAGTGGACAACCTTTCACGAGGAAATATGGGAGCTGTGAGGATTC
TGCAGGAATTATTTCCTGAACCAGGGAGGCTTCAGTTTATATATGCTGACTTGGGGGATGCAAAAGTGGTCCACCCX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan