ESTScan Details for Unigene SGN-U335965

Score 
-107
Direction 
Reverse
Predicted Peptide Sequence 
GCGSAPTFLSLRSTIGISLEDRATSTGEGGESLTGKDTPRKIAAPVYKRVTETHYCVDPLGFPKDVVPGGVPAGIPVVEHAYSPPFREIR
NSPSPQAEQTQCALRSCERGNPKEAPNIANRPLPVGWADSINAVATPGFQDGKAGRKRNPINGGSSIIRHPKALHVMIPASXLVRKREXD
NDFTQETAMTMITPSSKLTLTKGNKSWSSPAEAAALELWIPRAAGIRHEASVAMAETFDPDIYQGPDEKITAPAKTSGGILLPEKSSKLN
SGKVVAVGPGLHDKTGNLIPTAVKEGDTVLLPEYDNTQ
Predicted Coding Sequence 
GGGTGTGGTTCGGCCCCCACCTTTTTGAGTTTAAGAAGCACGATTGGCATTTCTCTTGAAGATCGGGCTACGTCAACGGGGGAGGGCGGA
GAATCCCTTACTGGAAAAGATACCCCCAGGAAGATAGCGGCGCCCGTGTATAAGCGGGTTACCGAGACCCATTATTGCGTGGACCCTCTT
GGGTTCCCAAAAGATGTTGTCCCAGGGGGTGTTCCCGCCGGAATTCCGGTGGTAGAGCACGCTTATTCCCCCCCTTTTAGAGAAATCAGG
AATTCCCCTTCGCCGCAAGCAGAACAGACCCAATGCGCATTAAGATCATGTGAGCGAGGGAACCCGAAAGAAGCACCCAATATCGCAAAC
CGACCTCTCCCAGTGGGGTGGGCTGATTCCATAAATGCAGTAGCCACGCCAGGTTTCCAGGACGGAAAAGCGGGCAGGAAGCGCAACCCA
ATTAATGGAGGTAGTTCAATCATTAGGCACCCCAAGGCTTTACACGTAATGATTCCGGCTAGTXACCTTGTGAGGAAACGTGAGCXGGAT
AACGATTTCACACAGGAAACAGCTATGACCATGATTACGCCAAGCTCGAAATTAACCCTCACTAAAGGGAACAAAAGCTGGAGCTCCCCC
GCGGAGGCGGCCGCTCTAGAGCTATGGATCCCCCGGGCTGCAGGAATTAGGCACGAGGCTTCAGTAGCCATGGCXGAAACGTTTGATCCC
GACATTTATCAGGGTCCTGATGAGAAAATTACAGCTCCCGCTAAAACAAGTGGTGGTATTCTTCTCCCTGAGAAGTCATCTAAGTTGAAT
TCAGGGAAAGTAGTGGCTGTTGGACCAGGACTTCATGACAAGACAGGGAACTTGATACCTACTGCTGTCAAGGAAGGTGACACCGTCTTG
TTGCCTGAGTACGATAATACTCAA
Edits in Original Sequence 
(5')GGGTGTGGTTCGGCCCCCACCTTTTTGAGTTTAAGAAGCACGATTGcGCATTTCTCTTGAAGATCGGGCTACGTCAACGGGGGAGG
GCGGAGAATCCCTTACTGGcAAAAGATACCCCCAGGAAGATAGCGGCGCCCGTGTATAAGCGGGTTACCGAGACCCATTATTGCGTGGAC
CCTCTTGGGTTCCCAAAAGtATGTTGTCCCAGGGGGTGTTCCCGCCGGAATTCCGGTGGTAGAGCACGCTTATTCCCCCCCTTTTAGAGA
AATCAGGAATTCCCCTTCGCCGCAAGCAGAACAGACCCAATGCGCATTAAGATCATGTGAGCGAGGGAACCCGAAAGAAGCACCCAATAT
CGCAAACCGACCTCTCCCAGTGGGGTGGGCTGATTCCATAAATGCAGTAGCCACGCCAGGTTTCCAGGACGGAAAAGCGGGCAGGAAGCG
CAACCCAATTAATGtGAGGTAGTTCAATCATTAGGCACCCCAAGGCTTTACACGTAATGATTCCGGCTAGTXACCTTGTGAGGAAACGTG
AGCXGGATAACGATTTCACACAGGAAACAGCTATGACCATGATTACGCCAAGCTCGAAATTAACCCTCACTAAAGGGAACAAAAGCTGGA
GCTCCCCCGCGGAGGCGGCCGCTCTAGAGCTAgTGGATCCCCCGGGCTGCAGGAATTAGGCACGAGGCTTCAGTAGCCATGGCXGAAACG
TTTGATCCCGACATTTATCAGGGTCCTGATcGAGAAAATTACAGCTCCCGCTAAAACAAGTGGTGGTATTCTTCTCCCTGAGAAGTCATC
TAAGTTGAATTCAGGGAAAGTAGTGGCTGTTGGACCAGGACTTCATGACAAGACAGGGAACTTGATACCTACTGCTGTCAAGGAAGGTGA
CACCGTCTTGTTGCCTGAGTACGATAATACTCAA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan