ESTScan Details for Unigene SGN-U336015

Score 
-452
Direction 
Forward
Predicted Peptide Sequence 
TIHWPSFYNVVTGKTLALPNXNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNILLKFALIFVKSAHFLTNRPKSAKSLINQ
KNRPEIGLSVVPVWNKSPPLKNVDSNVKGRKTVYQGDGPLREPXTLIKFLGVEGPESTKIGTLKGTPDLKFEGENPAKRGQKKEGKKSEK
ERGALGPWQIVRGPLVRKNKKPGG
Predicted Coding Sequence 
ACAATTCACTGGCCGTCGTTTTACAACGTCGTGACTGGGAAAACCCTGGCGTTACCCAACTTXAATCGCCTTGCAGCACATCCCCCTTTC
GCCAGCTGGCGTAATAGCGAAGAGGCCCGCACCGATCGCCCTTCCCAACAGTTGCGCAGCCTGAATGGCGAATGGCAAATTGTAAGCGTT
AATATTTTGTTAAAATTCGCGTTAATTTTTGTTAAATCAGCTCATTTTTTAACCAATAGGCCGAAATCGGCAAAATCCCTTATAAATCAA
AAGAATAGACCXGAGATAGGGTTGAGTGTTGTTCCAGTTTGGAACAAGAGTCCACCATTAAAGAACGTGGACTCCAACGTCAAAGGGCGA
AAAACCGTCTATCAGGGCGATGGCCCACTACGTGAACCAXTCACCCTAATCAAATTTTTGGGGGTCGAGGGGCCCGAAAGCACTAAAATC
GGAACCCTTAAGGGGACCCCCGATTTAAAATTTGAGGGGGAAAACCCGGCCAAACGTGGGCAGAAAAAGGAAGGGAAAAAAAGCGAAAAG
GAGCGGGGCGCCTTGGGCCCTTGGCAAATTGTTCGGGGACCCCTTGTCCGTAAAAACAAAAAACCCGGCGGG
Edits in Original Sequence 
GTTTGTCGTCCCCTATCCATTCCCATTCTAGCTTTGAACTTTTGAGTTGTACATGAAATGTTGATTGAACAATCAACTTTGAGTGCTTTT
TTCTGAATTGTTAATCCATTTAATAACTATCACCATGAGTATGTTGAGGAGATGCAAAACACATGATTAATCGCTCTATACATTGAATAT
CTTATTTGTG
(5')ACAATTCACTGGCCGTCGTTTTACAACGTCGTGACTGGGAAAACCCTGGCGTTACCCAACTTXAATCGCCTTGCAG
CACATCCCCCTTTCGCCAGCTGGCGTAATAGCGAAGAGGCCCGCACCGATCGCCCTTCCCAACAGTTGCGCAGCCTGAATGGCGAATGGC
AAATTGTAAGCGTTAATATTTTGTTAAAATTCGCGTTaAATTTTTGTTAAATCAGCTCATTTTTTAACCAATAGGCCGAAATCGGCAAAA
TCCCTTATAAATCAAAAGAATAGACCXGAGATAGGGTTGAGTGTTGTTCCAGTTTGGAACAAGAGTCCACCATTAAAGAACGTGGACTCC
AACGTCAAAGGGCGAAAAACCGTCTATCAGGGCGATGGCCCACTACGTGAACCAXTCACCCTAATCAAATTTTTGGGGGTCGAGGGGCCC
GAAAGCACTAAAATCGGAACCCTTAAGGGGAcCCCCCGATTTAAAAcTTTGAGGGGGAAAACCCGGCCAAACGTGGGCAGAAAAAGGAAG
GGAAAAAAAGCGAAAAGGAGCGGGGCGCCTTGGGCCCTTGGCAAATTGTTCGGGGACCCCTTGTCCGTAAAAACAAAAAACCCGtGCGGG
(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan