ESTScan Details for Unigene SGN-U336079

Score 
43
Direction 
Reverse
Predicted Peptide Sequence 
DGVPNRKGPISFTKTGVFGSRSNKWLRFDEKAQPFILSGASGGGNXPVWDFNGSLLPSVSEKVCQSLVICPPVTAFHELKFYWESSFTHA
LFHPSYPALLVIGGMRSLELWDMVENKSMTVPAHENIIAALAQSPATGMVGSASHDSSVKLWK
Predicted Coding Sequence 
GACGGGGTCCCAAACAGAAAAGGCCCAATAAGTTTCACCAAAACTGGGGTTTTTGGCTCCCGCTCAAATAAATGGTTACGTTTTGATGAA
AAAGCACAGCCATTTATTCTTTCAGGGGCATCCGGAGGGGGTAACTXCCCTGTGTGGGATTTCAATGGTAGTTTACTGCCATCAGTAAGT
GAGAAGGTCTGTCAAAGTTTGGTCATTTGCCCACCGGTGACTGCATTTCATGAGTTAAAGTTCTACTGGGAATCAAGTTTCACTCATGCG
TTATTTCATCCTAGTTATCCTGCTCTATTGGTGATTGGAGGAATGAGGTCTCTGGAGCTGTGGGACATGGTTGAGAACAAAAGCATGACG
GTTCCAGCACATGAGAACATTATTGCTGCACTAGCACAGTCACCGGCGACTGGAATGGTTGGCTCTGCAAGTCATGACAGTTCGGTCAAG
TTATGGAAATAG
Edits in Original Sequence 
GCTCTATTGGTGATTGGAGGAATGAGGTCTCTGGAGCTGTGGGACA(5')GACGGGGTCCCAAACAGAAAAGGCCCAATAAGTTTCACCA
AAACTGGGGTTTTTGGCTCCCGCTCAAATAAATGGTTACGTTTTGATGtAAAAAGCACAGCCATTTATTCTTTCAGGGGCATCCGGAGGG
GGTAACTXCCCTGTGTGGGATTTCAATGGTAGTTTACTGCCATCAGTAAGTGAGAAGGTCTGTCAAAGTTTGGTCATTTGCCCACCGGTG
ACTGCATTTCATGAGTTAAAGTTCTACTGGGAATCAAGTTTCACTCATGCGTTATTTCATCCTAGTTATCCTGCTCTATTGGTGATTGGA
GGAATGAGGTCTCTGGAGCTGTGGGACATGGTTGAGAACAAAAGCATGACGGTTCCAGCACATGAGAACATTATTcGCTGCACTAGCACA
GTCACCGGCGACTGGAATGGTTGGCTCTGCAAGTCATGACAGTTCGGTCAAGTTATGGAAATAG(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan