ESTScan Details for Unigene SGN-U336094

Score 
-8
Direction 
Reverse
Predicted Peptide Sequence 
AFWGPIWGIREVEPALTPNFPNLTGDQRCKWGRKAPKYARGAVVVVVQPDPGSSRRLDLWHPSWAARDTGHWAANCLMEAVKVTVMLVXP
LGRLSTPPLLRCSYEHKGLAKIPEGXAELKVKKIKKARLDMFSMSGFYVQDIVTGKGPLENSXLTTLAGPVVNNAWAFATNFVPGK
Predicted Coding Sequence 
XGTGCCTTTTGGGGCCCAATTTGGGGAATCCGGGAGGTTGAACCGGCTCTCACCCCTAACTTTCCAAACCTAACGGGGGACCAGCGGTGC
AAGTGGGGAAGGAAGGCTCCAAAGTATGCCCGCGGTGCAGTTGTGGTTGTTGTTCAGCCGGATCCCGGTTCCAGCAGGAGGCTTGACCTT
TGGCATCCAAGCTGGGCAGCACGAGACACTGGCCACTGGGCTGCCAATTGTCTGATGGAAGCCGTTAAGGTAACAGTAATGCTGGTTGAX
CCTCTAGGTAGGTTGTCGACCCCCCCTCTACTCCGGTGCAGCTACGAACACAAAGGCCTTGCTAAGATCCCCGAAGGTXTTGCTGAGCTC
AAGGTAAAGAAGATTAAGAAGGCAAGACTTGATATGTTCTCTATGTCCGGATTCTATGTACAGGACATTGTTACCGGAAAGGGTCCATTG
GAGAACTCTXTTCTGACCACACTTGCAGGCCCCGTGGTCAACAACGCTTGGGCTTTCGCCACAAACTTTGTCCCCGGAAAATGA
Edits in Original Sequence 
(5')XGTGCCTTTTGGGGCCCAATTTGGGGAATCCGGGAGGTTGAACCGGCTCTCACCCCTAACTTTCCAAACCTAACGGGGGACCAGCG
GTGCAAGTGGGGAAGGAAGGCTCCAAAGTATGCCCGaCGGTGCAGTTGTaGGTTGTTGTTCAGCCGGATCCCGGTTCCAGCAGGAGGCTT
GACCTTTGGCATCCAAGCTGGGCAGCACGAGACACTGGCCACTGGGCTGCCAATTGTCTGATGGAAGCCGTTAAGGTAACAGTAATGCTG
GTTGAXCCTCTAGGTAGGTTGTCGACCCCCCCTCTACTCCGGTGCAGCTACGAACACAtAAGGCCTTGCTAAGATCCCCGAAGGTXTTGC
TGAGCTCAAGGTAAAGAAGATTAAGAAcGGCAAGACTTGATATGTTCTCTATGTCCGGATTCTATGTACAGGACATTGTTACCGGAAAGG
GTCCATTGGAGAACTCTXTTCTGACCACACTTGCAGGCCCCGTGGTCAACAACGCTTGGGCTTTCGCCACAAACTTTGTCCCCGGAAAAT
GA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan