ESTScan Details for Unigene SGN-U336095

Score 
-503
Direction 
Reverse
Predicted Peptide Sequence 
KAVRAETGGVLCPPAPAWRERPSPEMEILSAVSYEKAATFPEGRKADRFPVSGRVGTGERTRELPGGKPGIFIVLSGFATSDLSVDFCDA
RQGGGAYGKTPATAAFLRFLAFCWPFAHMFFPALSPDSVDNRITPLSELIPLAAAERPSAAESVSEEAEERPIRKPPLPAVGRFINAAGT
TGFPTGKRAVSATQLMELAHSLGTPGFTLYASGRMLCGIVTDNNFTQETAMTMITPSSKLTLTKGNKSWSSPAVAAALELVDPRAAGIWH
GILNMSFYEDLTFGTGRDIWH
Predicted Coding Sequence 
AAGGCGGTTCGGGCTGAAACGGGGGGGGTTTTGTGCCCCCCAGCCCCAGCTTGGAGGGAACGACCTTCCCCCGAAATGGAGATACTTTCA
GCXGTGAGTTATGAGAAAGCXGCCACGTTTCCCGAAGGGAGAAAGGCGGACAGGTTTCCGGTAAGCGGCAGGGTCGGAACAGGAGAGCGC
ACGAGGGAGCTTCCAGGGGGAAAGCCTGGTATCTTTATAGTCCTGTCGGGTTTCGCCACCTCTGACTTGAGCGTCGATTTTTGTGATGCT
CGTCAGGGGGGCGGAGCCTATGGAAAAACGCCAGCAACXGCGGCCTTTTTACGGTTCCTGGCCTTTTGCTGGCCTTTTGCTCACATGTTC
TTTCCTGCGTTATCCCCTGATTCTGTGGATAACCGTATTACCCCTTTGAGTGAGCTGATACCGCTCGCCGCAGCCGAACGACCGAGCGCA
GCXGAGTCAGTGAGCGAGGAAGCGGAAGAGCGCCCAATACGCAAACCGCCTCTCCCCGCCGTTGGCCGATTCATTAATGCAGCTGGCACG
ACAGGTTTCCCGACTGGAAAGCGGGCAGTGAGCGCAACGCAATTAATGGAGTTAGCTCACTCATTAGGCACCCCAGGCTTTACACTTTAT
GCTTCCGGCCGTATGTTGTGTGGAATTGTGACGGATAACAATTTCACACAGGAAACAGCTATGACCATGATTACGCCAAGCTCGAAATTA
ACCCTCACTAAAGGGAACAAAAGCTGGAGCTCCCCCGCGGTGGCGGCCGCTCTAGAACTAGTGGATCCCCGGGCTGCAGGAATTTGGCAC
GGGATCTTGAATATGAGTTTTTACGAGGACCTCACATTTGGTACTGGTAGAGACATATGGCATTAG
Edits in Original Sequence 
(5')AAGGCGGTTCGGGCTGAAACGGGGGGGGTTTTGTGCCCCCCAGCCCCAGCTTGGAGcGGAACGACCTTCCCCCGAAATGGAGATAC
TTTCAGCXGTGAGTTATGAGAAAGCXGCCACGTTTCCCGAAGGGAGAAAGGCGGACAGGTTTCCGGTAAGCGGCAGGGTCGGAACAGGAG
AGCGCACGAGGGAGCTTCCAGGGGGAAAcGCCTGGTATCTTTATAGTCCTGTCGGGTTTCGCCACCTCTGACTTGAGCGTCGATTTTTGT
GATGCTCGTCAGGGGGGCGGAGCCTATGGAAAAACGCCAGCAACXGCGGCCTTTTTACGGTTCCTGGCCTTTTGCTGGCCTTTTGCTCAC
ATGTTCTTTCCTGCGTTATCCCCTGATTCTGTGGATAACCGTATTACCgCCTTTGAGTGAGCTGATACCGCTCGCCGCAGCCGAACGACC
GAGCGCAGCXGAGTCAGTGAGCGAGGAAGCGGAAGAGCGCCCAATACGCAAACCGCCTCTCCCCGCgCGTTGGCCGATTCATTAATGCAG
CTGGCACGACAGGTTTCCCGACTGGAAAGCGGGCAGTGAGCGCAACGCAATTAATGtGAGTTAGCTCACTCATTAGGCACCCCAGGCTTT
ACACTTTATGCTTCCGGCtCGTATGTTGTGTGGAATTGTGAgCGGATAACAATTTCACACAGGAAACAGCTATGACCATGATTACGCCAA
GCTCGAAATTAACCCTCACTAAAGGGAACAAAAGCTGGAGCTCCCCCGCGGTGGCGGCCGCTCTAGAACTAGTGGATcCCCCGGGCTGCA
GGAATTTGGCACGGGATCTTGAATATGAGTTTTTACGAGGACCTCtACATTTGGTACTGGTAGAGACATATGGCATTAG(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan