ESTScan Details for Unigene SGN-U336103

Score 
220
Direction 
Reverse
Predicted Peptide Sequence 
RPGGGGXKGGKEVKLYSIALFNWVFGMKTIPGAVVSGSKTNLANLVEGPPRASWALSASKQWPTVQVVSCXVKAGSYLRRRVAYLPPKFV
KHKAFGPLGLTSCLMEAVKVPVAGGPLGRVVDPLYPVRFGPKGLVKDPEAFAKLKVKEIKNGSLAMFSMFGFFVQAIVTGKGPLENLADP
LADPVNNNAWAFATNFVPGK
Predicted Coding Sequence 
ANGNNNNNNNNNNNNNNNNCCCGCCCCGGGGGGGGGGGTAGNAAAGGGGGTAAGGAGGTTAAATTGTATTCTATTGCCCTTTTTAATTGG
GTGTTTGGGATGAAGACAATCCCCGGGGCTGTGGTATCGGGCTCAAAAACTAACCTTGCAAACCTTGTGGAGGGGCCTCCAAGGGCTAGT
TGGGCCTTGAGTGCCTCAAAACAATGGCCGACGGTTCAAGTTGTGAGCTGTGXTGTCAAAGCCGGTTCATATTTAAGAAGGAGGGTTGCC
TACTTGCCACCCAAGTTTGTCAAGCACAAAGCTTTTGGXCCATTGGGGTTGACAAGTTGTCTTATGGAAGCCGTTAAGGTTCCGGTTGCT
GGTGGACCTCTTGGTAGGGTGGTGGACCCACTTTACCCGGTGAGGTTTGGACCCAAAGGCCTTGTTAAAGACCCCGAGGCATTTGCTAAG
CTCAAGGTAAAGGAGATTAAGAACGGCAGCCTTGCTATGTTCTCTATGTTCGGATTCTTTGTTCAGGCCATTGTTACCGGAAAGGGTCCA
TTGGAGAACCTTGCTGACCCCCTTGCAGACCCCGTTAACAACAACGCTTGGGCTTTCGCCACAAACTTTGTCCCCGGAAAATGA
Edits in Original Sequence 
AGGGTCCATTGGAGAACCTTGCTGACCCCCTTGCAGACCCCGTTAACAACAACGCTTGGGCTTTCGCCACAAACTTTGTCCC(5')ANGN
NNNNNNNNNNNNNNNCCCGCCCCgGGGGGGGGGGGTAGNAAAGGGGGTAAGGAGGTTAAATTGTATTCTATTGCCCgTTTTTAATTGGGT
GTTTGGGATGAAGACAATCCCCGGGGCTGTGGTATCGGGCTCAAAAACTAACCTTGCAAACCTTGTGGAGGGGCCTCCAAGGGCTAGTTG
GGCCTTGAGTGCCTCAAAACAATGGCCGACGGTTCAAGTTGTGAGCTGTGXTGTCAAAGCCGGTTCATATTTAAGAAGGAGGGTTGCCTA
CTTGCCACCCAAGTTTGTCAAGCACAAAGCTTTTGGXCCATTGGGGTTGACAAGTTGTCTTATGGAAGCCGTTAAGGTTCCGGaTTGCTG
GTGGACCTCTTGGTAGGGTGGTGGACCCACTTTACCCGGTGcAGGTTTGGACCCAtAAGGCCTTGTTAAAGACCCCGAGGCATTTGCTAA
GCTCAAGGTAAAGGAGATTAAGAACGGCAGCCTTGCTATGTTCTCTATGTTCGGATTCTTTGTTCAGGCCATTGTTACCGGAAAGGGTCC
ATTGGAGAACCTTGCTGACCCCCTTGCAGACCCCGTTAACAACAACGCTTGGGCTTTCGCCACAAACTTTGTCCCCGGAAAATGA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan