ESTScan Details for Unigene SGN-U336113

Score 
792
Direction 
Forward
Predicted Peptide Sequence 
MAAATMALSSPSFAGQAVKLSPSASEISGNGRITMRKAVAKSAPSSSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPET
FAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGP
LGEVVDPLYPGGSFDPLGLAEDPVNNNAWAFATNFVPGK
Predicted Coding Sequence 
ATGGCAGCTGCTACAATGGCTCTTTCTTCTCCTTCTTTTGCCGGACAGGCAGTGAAACTCTCACCCTCTGCCTCAGAAATCTCTGGAAAT
GGAAGGATCACCATGAGAAAGGCTGTTGCCAAGTCTGCCCCATCTAGCAGTCCATGGTATGGCCCTGACCGTGTTAAGTACTTGGGCCCA
TTCTCTGGTGAGTCCCCAAGCTACTTGACTGGTGAATTCCCTGGTGACTACGGCTGGGATACCGCTGGACTCTCAGCAGACCCTGAAACC
TTTGCCAAGAACCGTGAACTCGAGGTGATCCACTGCAGATGGGCTATGCTTGGTGCTCTTGGATGTGTCTTCCCTGAGCTATTGGCCCGT
AACGGTGTCAAGTTCGGTGAGGCTGTGTGGTTCAAGGCCGGATCCCAGATCTTCAGCGAGGGAGGACTTGACTACTTGGGCAACCCAAGC
TTGGTCCATGCACAGAGCATCTTGGCCATCTGGGCTTGCCAAGTTGTCTTGATGGGAGCCGTTGAAGGTTACCGTATTGCTGGTGGACCT
CTTGGTGAGGTTGTCGACCCACTCTACCCCGGTGGCAGCTTCGACCCATTAGGCCTTGCTGAAGACCCCGTTAACAACAACGCTTGGGCT
TTCGCCACAAACTTTGTCCCCGGAAAATGA
Edits in Original Sequence 
GCAACTCCCTCATTTTCCTCTCTTTAAAAACCATGGCAGCTGCTACAATGGCTCTTTCTTCTCCTTCTTTTGCCGGACAGGCAGTGAAAC
TCTCACC
(5')ATGGCAGCTGCTACAATGGCTCTTTCTTCTCCTTCTTTTGCCGGACAGGCAGTGAAACTCTCACCCTCTGCCTCAGAAA
TCTCTGGAAATGGAAGGATCACCATGAGAAAGGCTGTTGCCAAGTCTGCCCCATCTAGCAGTCCATGGTATGGCCCTGACCGTGTTAAGT
ACTTGGGCCCATTCTCTGGTGAGTCCCCAAGCTACTTGACTGGTGAATTCCCTGGTGACTACGGCTGGGATACCGCTGGACTCTCAGCAG
ACCCTGAAACCTTTGCCAAGAACCGTGAACTCGAGGTGATCCACTGCAGATGGGCTATGCTTGGTGCTCTTGGATGTGTCTTCCCTGAGC
TATTGGCCCGTAACGGTGTCAAGTTCGGTGAGGCTGTGTGGTTCAAGGCCGGATCCCAGATCTTCAGCGAGGGAGGACTTGACTACTTGG
GCAACCCAAGCTTGGTCCATGCACAGAGCATCTTGGCCATCTGGGCTTGCCAAGTTGTCTTGATGGGAGCCGTTGAAGGTTACCGTATTG
CTGGTGGACCTCTTGGTGAGGTTGTCGACCCACTCTACCCCGGTGGCAGCTTCGACCCATTAGGCCTTGCTGAAGACCCCGTTAACAACA
ACGCTTGGGCTTTCGCCACAAACTTTGTCCCCGGAAAATGA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan