ESTScan Details for Unigene SGN-U336200

Score 
-201
Direction 
Reverse
Predicted Peptide Sequence 
STGPELGEEATLTPELEIPYQGGVMEKRRHAFPEGRKGGPVFRLSGRVRTRRGARGSFQGETPGFFIVLSGFATSDLSVDFCDARQGGGA
YGKTPATAAFLRFLAFCWPFAHMFFPALSPDSVDNRITPLSELIPLAAAERPSAAESVSEEAEERPIRKPPLPAVGRFINAAGTTGFPTG
KRAVSATQLMELAHSLGTPGFTLYASGRMLCGIVTDNNFTQETAMTMITPSSKLTLTKGNKSWSSTAVAAAXRTSGSPGLQEFGTRLKYL
KAKAKSHQKAEAKAHPEREQYAAFAVC
Predicted Coding Sequence 
TCCACAGGCCCAGAGCTTGGAGAGGAAGCGACCCTTACACCCGAACTGGAGATTCCTTACCAGGGGGGAGTTATGGAGAAAAGGCGCCAC
GCXTTCCCCGAAGGAAGAAAAGGCGGGCCGGTATTCCGGTTAAGCGGCAGGGTTCGAACCAGGAGAGGCGCACGAGGGAGTTTCCAGGGG
GAAACGCCTGGATTCTTTATAGTCCTGTCGGGTTTCGCCACCTCTGACTTGAGCGTCGATTTTTGTGATGCTCGTCAGGGGGGCGGAGCT
TATGGAAAAACGCCAGCAACXGCGGCCTTTTTACGGTTCCTGGCCTTTTGCTGGCCTTTTGCTCACATGTTCTTTCCTGCGTTATCCCCT
GATTCTGTGGATAACCGTATTACCCCTTTGAGTGAGCTGATACCGCTCGCCGCAGCCGAACGACCGAGCGCAGCXGAGTCAGTGAGCGAG
GAAGCGGAAGAGCGCCCAATACGCAAACCGCCTCTCCCCGCCGTTGGCCGATTCATTAATGCAGCTGGCACGACAGGTTTCCCGACTGGA
AAGCGGGCAGTGAGCGCAACGCAATTAATGGAGTTAGCTCACTCATTAGGCACCCCAGGCTTTACACTTTATGCTTCCGGCCGTATGTTG
TGTGGAATTGTGACGGATAACAATTTCACACAGGAAACAGCTATGACCATGATTACGCCAAGCTCGAAATTAACCCTCACTAAAGGGAAC
AAAAGCTGGAGCTCCACCGCGGTGGCGGCCGCTXCTAGAACTAGTGGATCCCCCGGGCTGCAGGAATTCGGCACGAGGCTCAAGTATCTC
AAGGCTAAAGCCAAGTCTCACCAGAAAGCTGAAGCTAAGGCACATCCTGAAAGAGAGCAGTATGCCGCATTTGCTGTCTGTTAA
Edits in Original Sequence 
(5')TCCACAGGCCCAGAGCTTGGAGAGGAAGCGACCCTTACACCCGAACTGGAGATTCCTTACCAGGGGGGAGTTATGGAGAAAAGGCG
CCACGCXTTCCCCGAAGGAAGAAAAGGCGGGCCGGTATTCCGGTTAAGCGGCAGGGTTCGAACCAGGAGAGGCGCACGAGGGAGTTTCCA
GGGGGAAACGCCTGGATTCTTTATAGTCCTGTCGGGTTTCGCCACCTCTGACTTGAGCGTCGATTTTTGTGATGCTCGTCAGGGGGGCGG
AGCTTATGGAAAAACGCCAGCAACXGCGGCCTTTTTACGGTTCCTGGCCTTTTGCTGGCCTTTTGCTCACATGTTCTTTCCTGCGTTATC
CCCTGATTCTGTGGATAACCGTATTACCgCCTTTGAGTGAGCTGATACCGCTCGCCGCAGCCGAACGACCGAGCGCAGCXGAGTCAGTGA
GCGAGGAAGCGGAAGAGCGCCCAATACGCAAACCGCCTCTCCCCGCgCGTTGGCCGATTCATTAATGCAGCTGGCACGACAGGTTTCCCG
ACTGGAAAGCGGGCAGTGAGCGCAACGCAATTAATGtGAGTTAGCTCACTCATTAGGCACCCCAGGCTTTACACTTTATGCTTCCGGCtC
GTATGTTGTGTGGAATTGTGAgCGGATAACAATTTCACACAGGAAACAGCTATGACCATGATTACGCCAAGCTCGAAATTAACCCTCACT
AAAGGGAACAAAAGCTGGAGCTCCACCGCGGTGGCGGCCGCTXCTAGAACTAGTGGATCCCCCGGGCTGCAGGAATTCGGCACGAGGCTC
AAGTATCTCAAGGCTAAAGCCAAGTCTCACCAGAAAGCTGAAGCTAAGGCACATCaCTGAAAGAGAGCAGTATGCCGCATTTGCTGTCTG
TTAA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan