ESTScan Details for Unigene SGN-U336289

Score 
347
Direction 
Forward
Predicted Peptide Sequence 
MNRGGIGIGGPMRKSFKDSLKVLEADIQHANTLASDFPESTWGLPTDENVLHPASIREFYAVIYPSLLQLERGVTDSEDKKQKAVCQERY
RRRDDEDYRQSSDSDIEREEECGICMEMNSKIVLPKCXSRPVFEMLS
Predicted Coding Sequence 
ATGAATAGAGGAGGAATTGGAATTGGAGGGCCAATGCGAAAGTCTTTTAAGGACTCTCTTAAAGTTCTTGAAGCTGATATTCAGCATGCT
AATACTCTGGCATCTGATTTCCCCGAGAGTACATGGGGCCTGCCTACAGATGAGAATGTCCTACATCCAGCAAGCATTAGGGAGTTCTAT
GCTGTTATTTATCCCTCCTTACTTCAACTTGAAAGAGGTGTTACGGATTCAGAAGACAAAAAGCAAAAAGCAGTTTGCCAGGAGAGATAC
AGGAGAAGAGATGATGAGGATTACAGACAATCTTCTGACTCTGACATTGAAAGGGAAGAGGAATGTGGAATCTGCATGGAAATGAACAGC
AAAATTGTCCTTCCCAAATGCAAXTCACGCCCTGTGTTTGAAATGCTATCGTGA
Edits in Original Sequence 
GATTCTGTACAGTAAAAGAAGCTGTGAAAAAGAAAGAAGAAACAGAGTCATCAAAATTTGGGGAAAATTCTTACAAGAGAATCGAATAGA
TTTTGATTTGAGGAAAAAAAGGGGTGGTGTTGAAGTGGATTTGTGATGGTAAGGAGTGTTTGGTTGTGAGTAAAATTCGTTTTTTCTTTT
TTGGGTTTTGGGTGGTTGGAGTAAAGAGCGAAAGAGAAGGAAAATTGCAGGTATGAATAGAGGAGGAATTGGAATTGGAGGGCCAATGCG
AAAGTCTTTTAAGGACTCTCTTA
(5')ATGAATAGAGGAGGAATTGGAATTGGAGGGCCAATGCGAAAGTCTTTTAAGGACTCTCTTAAA
GTTCTTGAAGCTGATATTCAGCATGCTAATACTCTGGCATCTGAcTTTCCCCGAGAGTACgATGGGGCCTGCCTACAGATGAGAATGTCC
TACAgTCCAGCAAGCATTAGGGAGTTCTATGCTGTTATTTATCCCTCCTTACTTCAACTTGAAAGAGGTGTTACGGATTCAGAAGACAAA
AAGCAAAAAGCAGTTTGCCAGGAGAGATACAGGAGAAGAGATGATGAGGATTACAGACAATCTTCTGACTCTGACATTGAAAGGGAAGAG
GAATGTGGAATCTGCATGGAAATGAACAGCAAAATTGTCCTTCCCAAATGCAAXTCACGCCCTGTGTTTGAAATGCTATCGTGA(3')TA
TTCAGATCTCTATCATCCCACGCCAACTCTACATTTCCTTTGCACTCTTTCTAACCCCCTTCATACACTTTGATGTTCACAGAACAGCTG
TCGAGTGCTTCCTGGGGTGAGGTTCTGTGGG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan