ESTScan Details for Unigene SGN-U336339

Score 
170
Direction 
Forward
Predicted Peptide Sequence 
CPATIYFKSGEIRKNXNFILTKXLINRTFKSTEIDADEGLEPTWNGNPWRSSTAVAAGLELWDPRAAGKNHRLGSLVNIKNLXFSTMGGD
NTEKITIMMLKVDLHDQAATKKQKILCKFPQIRDQVYDEKANIITITVLGGKPEKFGTNWVAKEGEESRALRSKSLKRPKKSEKPKEPEK
PKGVEKPKEPEKPKVVEKPKELEKPKRVVGEKPREPEKPKRGGGKKPKNQENLKGRRRPKNPEKPKKGGGGRNLKKRERPKNPGRPREPK
KPKKPKKAREVRKPKEPKKAKKTPKPGPRGGYPHRQTPGEHELRQLETEEGKAGRVSQPPHREDVGGKYKGYGGLXIIDGREKYNTDPHG
GKIKGKARPDIPETGR
Predicted Coding Sequence 
XCGTGTCCGGCTACTATATATTTCAAGTCAGGGGAGATACGAAAAAACATNAATTTTATCCTTACCAAAGAXCTAATTAACAGAACCTTC
AAAAGCACGGAGATAGACGCAGACGAGGGACTTGAGCCCACTTGGAATGGAAACCCTTGGAGGAGCTCCACCGCGGTGGCGGCCGGTCTA
GAACTATGGGACCCCCGGGCTGCAGGAAAAAACCATAGATTAGGTTCACTTGTAAATATCAAAAATCTTAGXTTCTCAACTATGGGTGGT
GACAATACTGAGAAGATTACCATAATGATGCTAAAGGTTGATCTTCATGATCAAGCTGCTACAAAAAAGCAAAAAATTCTCTGCAAATTC
CCTCAAATTCGAGACCAAGTGTATGATGAAAAGGCCAATATAATCACAATTACTGTATTGGGGGGCAAACCTGAAAAATTCGGGACAAAT
TGGGTTGCAAAGGAGGGGGAGGAATCAAGAGCATTGAGATCAAAGAGTCTCAAAAGGCCAAAGAAATCGGAAAAACCCAAAGAGCCCGAA
AAGCCCAAGGGGGTGGAGAAGCCTAAAGAGCCCGAGAAGCCCAAGGTGGTGGAGAAGCCTAAAGAGCTCGAGAAACCCAAAAGAGTAGTC
GGGGAGAAGCCTAGAGAACCTGAGAAACCCAAACGGGGTGGTGGGAAGAAGCCTAAGAATCAGGAGAACCTAAAGGGTAGGAGAAGGCCA
AAGAACCCGGAAAAACCCAAAAAAGGGGGXGGGGGGAGAAACCTAAAAAAGCGGGAAAGGCCAAAGAACCCTGGAAGACCAAGGGAACCA
AAGAAGCCTAAAAAGCCCAAAAAGGCAAGGGAGGTTAGAAAGCCCAAAGAGCCGAAAAAGGCAAAGAAGACACCTAAACCAGGCCCACGG
GGAGGTTATCCGCATAGACAAACACCAGGCGAACACGAGTTGCGGCAGCTCGAAACAGAGGAAGGGAAGGCAGGTAGGGTATCACAACCA
CCCCATCGGGAGGATGTGGGGGGAAAGTACAAAGGCTACGGAGGGCTAGXTATAATAGATGGAAGGGAAAAATATAACACGGACCCACAC
GGTGGGAAAATAAAAGGAAAGGCACGCCCGGACATACCAGAGACCGGGAGA
Edits in Original Sequence 
(5')XCGTGTCCGGCTACTATATATTTCAAGTCAGGGGAGATACGAAAAAACATNAATTTTATCCTTACCAAAGAXCTAATTAACAGAAC
CTTCAAAAGCACGGAGATAGACGCAGACGAGGGACTTGAGCCCACTTGGAATGGAAACCCTTGGAGGAGCTCCACCGCGGTGGCGGCCGG
TCTAGAACTAgTGGGACCCCCGGGCTGCAGGAAAAAACCATAGATTAGGTaTCACTTGTAAATATCAAAAATCTTAGXTTCTCAACTATG
GGTGGTGACAATACTGAGAAGATTACCATAATGATGCTAAAGGTTGATCTTCaATGATCAAGCTGCTACAAAAAAGtCAAAAAATTCTCT
GCAAATTCCCTCAAATTCGAGACCAAGTGTATGATGAAAAGGCCAATATAATCACAATTACTGTATTGGGGGGCAAACCTGaAAAAATTC
GGGACAAATTGGGTTGCAAAGGAGGGGGAGGAATCAAGAGCATTGAGATCAAAGAGTCTCAAAAGGCCAAAGAAATCGGAAAAACCCAAA
GAGCCCGAAAAGCCCAAGGGGGTGGAGAAGCCTAAAGAGCCCGAGAAGCCCAAGGTGGTGGAGAAGCCTAAAGAGCTCGAGAAACCCAAA
AGAGTAGTCGGGGAGAAGCCTAGAGAACCTGAGAAACCCAAACGGGGTGGTgGGGAAGAAGCCTAAGAATCAGGAGAACCTAAAGGGTAG
GAGAAGGCCAAAGAACCCGGAAAAACCCAAAAAAGGGGGXGGGGGGAGAAACCTAAAAAAGCGGGAAAGGCCAAAGAACCCTGGAAGACC
AAGGGAACCAAAGAAGCCTAAAAAGCCCAAAAAGGCAAGGGAGGTTAGAAAGCCCAAAGAGCCGAAAAAGGCAAAGAAGACACCTAAACC
AGGCCCACGGGGAGGTTATCCGCATAGACAAACACCAGGCGAACACGAGTTGCGGCAGCTCGAAACAGAGGAAGGGAAGGCAGGTAGGGT
ATCACAACCACCCCATCGGGAGGATGTGGGGGGAAAGTACAAAGGCTACGGAGGGCTAGXTATAATAGATGGAAcGGGAAAAATATAACA
CGGACCCACACGGTGGGAAAATAAAAGGAAAGGCACGCCCGGACATACCAGAGACCGGGAGA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan