ESTScan Details for Unigene SGN-U336376

Score 
339
Direction 
Reverse
Predicted Peptide Sequence 
FVCGKNRGYXFARSLLPXGVKPDVDSSQTHVMHRHYHPVQNKELKGFGFSKMINGSEXPVVPYGLLINVGDQVEVMSNGIFKSPVHRVVX
NAERERNSLAVFIMPDVHVGIGPVEKLINEERPRGYKDIKNYVALFFQSYQQGKIPIEAAKISQEFH
Predicted Coding Sequence 
XGTTTTGTGTGTGGAAAAAACCGTGGATATNACTTCGCCAGATCACTTCTCCCCXCCGGTGTCAAGCCTGATGTGGACTCGAGTCAAACA
CATGTGATGCATCGGCATTACCATCCTGTGCAAAACAAAGAGTTGAAGGGCTTCGGGTTCTCAAAGATGATCAATGGTTCAGAGXTGCCT
GTTGTCCCATATGGTTTACTCATCAATGTTGGAGATCAAGTTGAGGTAATGAGCAATGGCATCTTTAAAAGCCCGGTGCACAGGGTGGTG
NCGAATGCAGAACGAGAAAGAAATAGCCTTGCTGTCTTCATTATGCCAGATGTACATGTTGGGATTGGACCAGTAGAGAAGCTTATCAAC
GAGGAAAGGCCGAGAGGGTACAAGGACATTAAGAATTATGTTGCTCTCTTCTTCCAAAGCTATCAGCAGGGGAAAATACCAATAGAAGCA
GCAAAGATAAGCCAAGAATTTCATTAG
Edits in Original Sequence 
(5')XGTTTTGTGTGTGGAAAAAACCGTGGATATNACTTCGCCAGATCACTTCTCCCCXCCGGTGTCAAGCCTGATGTGGACTCGAGTCA
AACACATGTGATGCATCGGCATTACCATCCTGTGCAAAACAAAGAGTTGAAGGGCTTCGGGTTCTCAAAGATGATCAATGGTTCAGAGXT
GCCTGTTGTCCCATATGGTTTACTCATCAATGTTGGAGATCAAGTTGAGGTAATGAGCAATGGCATCTTTAAAAGCCCGGTGCACAGGGT
GGTGNCGAATGCAGAACGAGAAAGAAATAGCCTTGCTGTCTTCATTATGCCAGATGTACATGTTGGGATTGGACCAGTAGAGAAGCTTAT
CAACGAGGAAAGGCCGAGAGGGTACAAGGACATTAAGAATTATGTTGCTCTCTTCTTCCAAAGCTATCAGCAGGGGAAAATACCAATAGA
AGCAGCAAAGATAAGCCAAGAATTTCATTAG(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan