ESTScan Details for Unigene SGN-U336382

Score 
284
Direction 
Reverse
Predicted Peptide Sequence 
MPLGXEVNEREGFWPVGKQNLPXLDKIKGKQFTDEKLIPIRDKVLRGEAKEAKIDEEGVLRIREGVCVPRVDDLIHTILYRLIVXKYSIH
PGANKMYRDLKQHFWWSRMKRDIVNFVAQCPNCQQVKYEHQRPGGTLQRMPIPEWKWERIAMDFVVSHPKTMGRYDSIWVIVDRLTKSAH
SISVKVTYNAEKLAKLYILEIVRLHGVPLSIISDRGTQFTSKFW
Predicted Coding Sequence 
ATGCCCTTAGGGNCTGAAGTAAATGAGAGGGAGGGATTCTGGCCTGTGGGGAAGCAAAATCTTCCTXTTCTTGACAAGATTAAGGGAAAG
CAGTTCACTGATGAGAAACTGATCCCGATTCGAGATAAGGTATTGCGAGGAGAGGCTAAAGAAGCAAAAATCGATGAGGAAGGTGTTTTG
AGAATAAGGGAAGGAGTATGTGTACCCCGCGTCGATGATTTGATTCACACTATTCTTTATAGGCTCATAGTTCXGAAGTACTCTATACAT
CCTGGTGCAAACAAGATGTATCGTGACCTAAAGCAACATTTTTGGTGGAGTAGGATGAAGCGTGACATTGTTAATTTTGTTGCTCAATGC
CCGAATTGTCAGCAAGTAAAGTATGAACACCAGAGGCCTGGAGGGACACTTCAGAGAATGCCCATTCCTGAATGGAAGTGGGAGAGAATT
GCAATGGACTTCGTGGTTAGTCATCCAAAGACGATGGGTAGGTATGACTCTATTTGGGTGATTGTTGACAGATTAACTAAGTCTGCTCAC
TCTATTTCGGTTAAGGTGACTTACAATGCAGAGAAGTTAGCCAAACTTTACATCTTAGAAATTGTTCGATTGCACGGAGTTCCACTCTCC
ATCATATCAGATAGAGGTACGCAATTTACTTCTAAGTTTTGG
Edits in Original Sequence 
GTATGTGTACCCCGCGTCGATGATTTGATTCACACTATTCTTATATAGGCTCATAGTTCGAAGTACTCTATACATCCTGGTGCAAACAAG
ATGTATCGTGACCTAAAGCAACATTTTTGGTGGAGTAGGATGAAGCGTGACATT
(5')ATGCCCTTAGGGNCTaGAAGTAAATGAGAGGG
AGGGATTCTGGCCTGTGGGGAAGCAAAATCTTCCTXTTCTTGACAAGATTAAGGGAAAGCAGTTCACTGATGAGAAACTGATCCCGATTC
GAGATAAGGTATTGCGAGGAGAGGCTAAAGAAGCAAAAATCGATGAGGAAGGTGTTTTGAGAATAAGGGAAGGAGTATGTGTACCCCGCG
TCGATGATTTGATTCACACTATTCTTaTATAGGCTCATAGTTCXGAAGTACTCTATACATCCTGGTGCAAACAAGATGTATCGTGACCTA
AAGCAACATTTTTGGTGGAGTAGGATGAAGCGTGACATTGTTAATTTTGTTGCTCAATGCCCGAATTGTCAGCAAGTAAAGTATGAACAC
CAGAGGCCTGGAGGGACACTTCAGAGAATGCCCATTCCTGAATGGAAGTGGGAGAGAATTGCAATGGACTTCGTGGTTAGTCATCCAAAG
ACGATGGGTAGGTATGACTCTATTTGGGTGATTGTTGACAGATTAACTAAGTCTGCTCACTCTATTTCGGTTAAGGTGACTTACAATGCA
GAGAAGTTAGCCAAACTTTACATCTTAGAAATTGTTCGATTGCACGGAGTTCCACTCTCCATCATATCAGATAGAGGTACGCAATTTACT
TCTAAGTTTTGG(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan