ESTScan Details for Unigene SGN-U336427

Score 
-285
Direction 
Forward
Predicted Peptide Sequence 
TIHWPSFYNVVTGKTLAVPNLIALQHIPPFPAGGNXEEARTVAFPTIATLNGQWANVNVNIFVKIXVKFLLNHSFFNQXGPNGKIPYYLK
IKRKRGEGWFRFETKIPFKKLDFNFKGEKPLSGEAP
Predicted Coding Sequence 
ACAATTCACTGGCCGTCGTTTTACAACGTCGTGACTGGGAAAACCCTGGCCGTACCCAACTTAATCGCCTTGCAGCACATCCCCCCTTTC
CCAGCTGGCGGTAATANCGAAGAAGCCCGCACCGTCGCCTTTCCCACAATTGCCACCCTGAATGGCCAATGGGCAAATGTAAACGTTAAT
ATTTTTGTTAAAATCGXCGTTAAATTTTTGTTAAATCACTCCTTTTTTAACCAAXTAGGGCCAAATGGCAAAATCCCTTATTATCTAAAA
ATAAAACGAAAAAGGGGTGAGGGGTGGTTCCGTTTTGAAACAAAAATCCCTTTTAAGAAACTGGACTTCAACTTCAAGGGCGAAAAACCG
TTATCAGGCGAAGCCCCX
Edits in Original Sequence 
GCTCTCACTTAATTTTCAGCTAGAGAAAGAAACAACTAGTAATTAACTATAGACAGAAGGAGAACAAAAGAACCAGCCATGGGAGTAGCT
CAAGCTAACCAAATGTGGTTACATCTCATGATCATCCTCTTCTCCTTCTCCATCTCCATTTCTTCTATTTCTGGAGCTGTAAGACACCCT
TCTCTAGTTTGAAATGACATAATAATAGATAAATATGCCGTTTAAGTTAGCTTTACCTTGCATTTATGTCTTTCTACTTTGATTGTAGAC
AAACAGACACTTCAATAAGCATAAATATGTGTCTATAGCGTATTACGGGTGAATTTGCATCCTGCTACATGATGTCCTACGTGTATTATG
TCTAGTTAATAAACGTATTTATACACTACAATAAAAATAATTATTCGCGGT
(5')ACAATTCACTGGCCGTCGTTTTACAACGTCGTGAC
TGGGAAAACCCTGGCCGTACCCAACTTAATCGCCTTGCAGCACATCCCCCCTTTCCCAGCTGGCGGTAATANCGAAGAAGCCCGCACCGa
TCGCCTTTCCCACAATTGCgCACCCTGAATGGCCAATGGGCAAATGTAAACGTTAATATTTTTGTTAAAATCGXCGTTAAATTTTTGTTA
AATCACTCCTTTTTTAACCAAXTAGGGCCAAATcGGCAAAATCCCTTATTATCTAAAAATAAAACGAAAAAGGGGTGAGGGGTGGTTCCG
TTTTGAAACAAAAATCCCTTTTAAGAAACTGGACTTCAACTTCAAGGGCGAAAAACCGTTATCAGGCGAAGCCCCX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan