ESTScan Details for Unigene SGN-U336503

Score 
337
Direction 
Forward
Predicted Peptide Sequence 
MGSDVFXNIVVGWKVRCAEYFVHSTYFGGIQSSPNNQVQKSPANGAVGLNAGENSSLSSNGKLEKLNALKDLQI
Predicted Coding Sequence 
ATGGGTAGTGATGTTTTTGAXAACATTGTTGTAGGATGGAAAGTTCGTTGTGCTGAGTACTTTGTCCACTCAACTTACTTTGGAGGTATT
CAAAGTTCACCTAACAATCAGGTACAAAAATCCCCTGCAAATGGAGCTGTAGGCCTAAATGCTGGTGAAAATTCTTCTCTTTCATCAAAT
GGTAAATTAGAGAAACTAAATGCGCTTAAGGATCTACAAATTTAA
Edits in Original Sequence 
GGGTGTTTGCAGAATCATTGATGCATAGGGCTGCTGTGGCTGAGTTGCTACATGTTCTGGAACCAAACAAGAAGGCTGAGGCTGTCAAAT
TAATTGAAGACTCTGTTAATGATCTTGTTTCTATGGACGGAGGAAAAGGAACTGTCAGGTCATGGAAATTGAACGACTGCATGACAGTTC
ACAAACTCCTGGAGACAACTCTGGTTGACCATGATGCTGCATCCAGTGAGTTCTTTACCATTGCGCACATCCTTCTGTCTTTTCATATTG
TACATCTCAAGTCTTCTCTTGGCCTGAAGTTGAGCTGAAGTTAACTGCATTCATATGTTTGACTCTGGTTCTGGTATATTGCTATTGTAG
CCTGTTCTTTTTTTTTTTCATGCATCCATTCCTTTTCTGTTGATTTGGGTGGCTGGGGGATATATTATTTTGTCTACGTTATGTATGAAA
TGATCCTTTTCTGTCAAATACATAAGTGACAACGTACTTACACGATATTTGATGATTCTATGGGTAGTGATGTTTTTGAAACATTGTTGT
AGGATGGAAAGTTCGTTGTGCTGAGTACTTTGTC
(5')ATGGGTAGTGATGTTTTTGAXAACATTGTTGTAGGATGGAAAGTTCGTTGTG
CTGAGTACTTTGTCCACTCAACTTACTTTGGAGGTATTCAAAGTTCACCTAACAATCAGGTACAAAAATCCCCTGCAAATGGAGCTGTAG
GCCTAAATGCTGGTGAAAATTCTTCTCTTTCATCAAATGGTAAATTAGAGAAACTAAATGCGCTTAAGGATCTACAAATTTAA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan