ESTScan Details for Unigene SGN-U336526

Score 
255
Direction 
Reverse
Predicted Peptide Sequence 
MPPCMGGGKSSXLTVGDCPIVPSLKCKTNFIVFMGARNGFCKQGRITLIILGMWGPPVVLKQWWAQYFVGGMVFSTIPTSVKATPPKQPH
FNPGKTTKFILKIPPFLGPLNILGGAVGPPLLHQTVNFLKIEKSVML
Predicted Coding Sequence 
ATGCCCCCATGTATGGGGGGTGGAAAAAGTTCAGXTTTAACGGTTGGTGACTGCCCAATTGTTCCATCTTTGAAATGCAAAACAAATTTT
ATTGTGTTTATGGGGGCTCGTAATGGTTTTTGTAAACAGGGAAGGATCACACTTATTATTTTGGGGATGTGGGGCCCACCAGTAGTGCTC
AAACAATGGTGGGCXCAGTATTTTGTAGGAGGAATGGTTTTTTCCACCATCCCAACAAGTGTAAAGGCAACTCCTCCAAAGCAGCCTCAT
TTCAACCCGGGCAAAACAACAAAGTTCATCCTTAAGATCCCCCCGTTTTTGGGTCCTTTGAATATTTTGGGAGGGGCTGTTGGCCCXCCG
CTTTTACACCAAACAGTCAACTTTTTGAAGATTGAAAAATCGGTGATGCTATAA
Edits in Original Sequence 
CCTCCAAAGCAGCCTCATTTCAACCCGGGCAAAACAACAAAGTTCATCCTTAAGATCCCCCCGTTTTTGGGTCCTTTGAATATTTTGGGA
GGGGCTGTTGGCCCCCGCTTTTACACCAAACAGTCAACTTTTTGAAGATTGAAAAATCGGTGATGCTATAACCACAAATGAAATCAACGA
GACGTT
(5')ATGCCCCCATGTATGGGGGGTGGAAAAAGTTCAGXTTTAACGGTTGGTGACTGCCCAATTGTTCCATCTTTGAAATGCAA
AACAAATTTTATTGTGTTTATGGGGGCTCGTAATGGTTTTTGTAAACAGGGAAGGATCACACTTATTATTTTGGGGATGTGGGGCCCACC
AGTAGTGCTCAAACAATGGTGGGCXCAGTATTTTGTAGGAGGAATGGTTTTTTCCACCATCCCAACAAGTGTAAAGGCAACTCCTCCAAA
GCAGCCTCATTTCAACCCGGGCAAAACAACAAAGTTCATCCTTAAGATCCCCCCGTTTTTGGGTCCTTTGAATATTTTGGGAGGGGCTGT
TGGCCCXCCGCTTTTACACCAAACAGTCAACTTTTTGAAGATTGAAAAATCGGTGATGCTATAA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan