ESTScan Details for Unigene SGN-U336537

Score 
288
Direction 
Forward
Predicted Peptide Sequence 
GPRGRGLGNRXLLKPWSSTAVAAAXRTSGSPGLQEFGTRFAEKNPKIEQTKVNLAMEVPGSSKKMIATQEEMVENKVPLAYRDQCAHLLI
PLNXXXGXXXXXGNGILSSMEVEDERHTYEKCAYELVMERMLQMQKIREEEARMKQKGHQSIPLIPKTANA
Predicted Coding Sequence 
GGGCCGAGGGGCAGGGGTCTTGGCAATCGTATNTTACTTAAACCCTGGAGCTCCACCGCGGTGGCGGCCGCTXCTAGAACTAGTGGATCC
CCCGGGCTGCAGGAATTCGGCACGAGGTTCGCAGAGAAAAATCCCAAAATCGAACAAACGAAAGTCAATTTGGCAATGGAGGTTCCAGGT
TCATCGAAGAAGATGATTGCAACACAAGAAGAAATGGTGGAGAACAAAGTGCCATTAGCATATAGGGATCAGTGCGCACACCTTTTGATC
CCTTTGAACAANGNNNTTGGNNTTNNNCNNGNNNGGGGCAATGGAATTTTATCTTCCATGGAAGTGGAGGATGAGCGCCATACATATGAG
AAGTGTGCGTATGAGCTTGTTATGGAACGGATGCTTCAGATGCAGAAGATCCGTGAAGAGGAAGCACGAATGAAGCAAAAGGGACATCAA
TCCATTCCTCTCATTCCTAAGACTGCTAATGCCTAG
Edits in Original Sequence 
(5')GGGCCGAGGGGCAGGGGTCTTGGCAATCGTATNTTACTTAAACCCTGGAGCTCCACCGCGGTGGCGGCCGCTXCTAGAACTAGTGG
ATCCCCCGGGCTGCAGGAATTCGGCACGAGGTTCGCAGAGAAAAATCCCAAAATCGAACAAACGAAAGTCAATTTGGCAATGGAGGTTCC
AGGTTCATCGAAGAAGATGATTGCAACACAAGAAGAAATGGTGGAGAACAAAGTGCCATTAGCATATAGGGATCAGTGCGCACACCTTTT
GATCCCTTTGAACAANGNNNTTGGNNTTNNNCNNGNNNGGGGCAATcGGAATTTTATCTTCCATGGAAGTGcGAGGATGAGCGCCATACA
TATGAGAAGTGTGCGTATGAGCTTGTTATGGAACGGATGCTTCAGATGCAGAAGATCCGTGAAGAGGAAGCACGAATGAAGCAAAAGGGA
CATCAATCCATTCCTCTCATTCCTAAGACTGCTAATGCCTAG(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan