ESTScan Details for Unigene SGN-U336657

Score 
21
Direction 
Forward
Predicted Peptide Sequence 
GGGGFXPKXXLXGSACWLRLLNTEPPRAAGIRHEGDTAGXPAAGPPHLSPASVCLTPHVSPEKTIINIDGLHHSIIEXGPVAWLGIFGHY
LRSIVCDPPYILSPSPSPPPVKQAKLPARKVPGDYGLPLVGPWKDRLDYFYNQGKDEFFTSRMKNHQDAVLRTNMPPRAXDLIQLQQRCN
ADGKSLPILFDVCKVEKKDLFTGTFMPSTDLTGGYRVLSYLDPSEPKHAKLKKLMLYLLHHDAVKLFRVHNATPAIETLKTLSPSKLAHA
XMTA
Predicted Coding Sequence 
GGAGGGGGGGGTTTTANNCCTAAAXTANCCTTAGNAGGNTCAGCCTGTTGGCTGAGACTTTTGAACACCGAACCXCCCCGGGCTGCAGGA
ATACGGCACGAGGGTGACACCGCCGGCAAXCCAGCTGCTGGACCXCCTCATCTTAGTCCGGCGTCGGTCTGCTTAACTCCTCATGTTTCT
CCGGAGAAGACTATAATCAACATTGATGGACTGCACCATTCTATCATTGAGXTAGGTCCTGTAGCTTGGCTAGGAATCTTTGGGCACTAT
CTACGCTCCATAGTGTGTGATCCACCTTACATTTTATCACCATCACCATCACCACCACCGGTTAAACAAGCGAAACTCCCAGCCAGAAAA
GTTCCTGGAGATTATGGACTACCATTAGTTGGTCCATGGAAGGACAGACTTGATTACTTCTACAATCAGGGCAAAGATGAATTCTTCACA
TCGAGAATGAAGAACCATCAGGATGCGGTGCTGCGAACGAACATGCCACCTAGGGCAXTTGACTTAATTCAACTGCAACAGAGGTGTAAT
GCTGATGGTAAAAGCTTACCCATCCTTTTTGATGTATGTAAAGTAGAAAAAAAGGATCTTTTCACCGGCACTTTCATGCCATCCACTGAT
CTCACAGGCGGTTATCGGGTTCTCTCCTATCTTGATCCTTCTGAACCAAAACATGCCAAATTGAAGAAACTCATGTTGTATCTCCTTCAT
CACGACGCAGTGAAGTTATTCAGAGTTCACAATGCTACTCCGGCTATTGAAACTCTGAAAACACTCTCACCAAGTAAACTGGCTCATGCA
XCAATGACAGCG
Edits in Original Sequence 
(5')GGAGGGGGGGGTTTTANNCCTAAAXTANCCTTAGNAGGNTCAGCCTGTTGGCTGAGACTTTTGAACACCGAACCXCCCCGGGCTGC
AGGAATACGGCACGAGGGTGACACCGCCGGCAAXCCAGCTGCTGGACCXCCTCATCTTAGTCCGGCGTCGGTCTGCTTAACTCCTCATGT
TTCTCCGGAGAAGACgTATAATCAACATTGATGGACTGCACCATTCTATCATTGAGXTAGGTCCTGTAGCTTGGCTAGGAATCTTTGGGC
ACTATCTACGCTCCATAGTGTGTGATaCCACCTTACATTTTATCACCATCACCATCACCACCACCGGTTAAACAAGCGAAACTCCCAGCC
AGAAAAGTTCCTGGAGATTATGGACTACCATTAGTTGGTCCATGGAAGGACAGACTTGATTACTTCTACAATCAGGGCAAAGATGAATTC
TTCACATCGAGAATGAAGAACCATCAGGATGCGGTGCTGCGAACGAACATGCCACCTAGGGCAXTTGACTTAATTCAACTGCAACAGAGG
TGTAATGCTcGATGGTAAAAGCTTACCCATCCTTTTTGATGTATGTAAAGTAGAAAAAAAGGATCTTTTCACCGGCACTTTCATGCCATC
CACTGATCTCACAGGCGGTTATCGGGTTCTCTCCTATCTTGATCCTTCTGAACCAAAACATGCCAAATTGAAGAAACTCATGTTGTATCT
CCtTTCATCACGACGCAGTGAAGTTATTCAGAGTTCACAATGCTACTCCGGCTATTGAAACTCTGAAAACgACTCTCACCAAGTAAACTG
GCTCATGCAXCAATGACAGCG(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan