ESTScan Details for Unigene SGN-U336778

Score 
-36
Direction 
Reverse
Predicted Peptide Sequence 
FLPWVEDSQTSVEGCPKTITGQALYNXFPPGHVYRVRGFQKTFPAPISCYQQIALIMNQTELGPQXAPVIPKFGFXTIPASLRNIVGLNH
PVLFPLFVAFPSVCTPNPSYKVSPLTFTKASHAALNVCSPIPGPRLTFCKGGVSQFSTAHHHDSMCLTMRIAAQIPAQCILPPLSCSAN
Predicted Coding Sequence 
XXTTTTTTGCCATGGGTTGAGGACTCCCAAACAAGTGTGGAGGGATGCCCAAAGACTATTACCGGCCAAGCACTGTATAATXATTTTCCC
CCAGGTCATGTATACCGCGTAAGGGGATTTCAGAAAACATTCCCCGCCCCTATTTCTTGTTACCAGCAAATTGCCCTCATAATGAACCAA
ACTGAGCTGGGCCCTCAGGXTGCCCCAGTGATCCCAAAATTTGGCTTTAXAACCATCCCAGCATCGCTAAGGAATATCGTTGGTCTTAAT
CACCCCGTTTTGTTCCCTTTGTTTGTTGCTTTCCCCAGTGTTTGTACGCCAAATCCAAGTTATAAAGTATCGCCCTTAACATTCACCAAA
GCGTCTCATGCTGCCCTCAACGTCTGCAGCCCCATTCCTGGTCCCAGGCTCACCTTCTGCAAGGGCGGAGTGTCGCAATTCAGTACAGCC
CATCATCATGACAGTATGTGCCTCACTATGCGCATTGCAGCTCAAATTCCAGCTCAGTGCATCCTCCCTCCACTCTCTTGTTCTGCAAAT
TGA
Edits in Original Sequence 
(5')XXTTTTTTGCCATGGGTTGAGGACTCCCAAACAAGTGTGGAGGGATGCCCAAAGACTATTACCGGCCAAGCACTGTATAATXATTT
TCCCCCAGGTCATGTATACCGCGTAAGGGGATTTCAGAAAACATTCCCCGCgCCCTATTTCTTGTTACCAGCtAAATTGCCCTCATAATG
AACCAAACTGAGCTGGGCCCTCAGGXTGCCCCAGTGATCCCAAAATTTGGCTTTAXAACCATCCCAGCATCGCTAAGGAATATCGTTGGT
CTTAATCACCCCGTTTTGTTCCCTTgTGTTTGTTGCTTTCCCCAGTGTTTGTACGCCAAATCCAAGTTATAAAGTATCGCCCTTAACATT
CACgCAAAGCGTCTCATGCTGCCCTCAACGTCTGCAGCCCCATTCCTGGTCCCAGGCTCACCTTCTGCAAGGGCGGAGTGTCGCAATTCA
GTACAGCCCAtTCATCATGACAGTATGTGCCTCACTATGCGCATTGCAGCTCAAATTCCAGCTCAGTGCATCCTCCCTCCACTCTCTTGT
TCTGCAAATTGA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan