ESTScan Details for Unigene SGN-U336779

Score 
173
Direction 
Forward
Predicted Peptide Sequence 
MLDGKLSDKSDVYGFGVGLLELLLGRRPVEKEAATECQSIVTWAMPHLTDRSKLPNIVDPVIQNTMDLKHLYQVAAVAXIMCSARAKLSS
ANNRCITFLNVPFYHTIGGDAYRLLNCLINPNYCMPLGLTQFFGYFFNLFNTNPDSLKPCG
Predicted Coding Sequence 
ATGTTAGATGGAAAATTAAGTGATAAAAGTGATGTTTATGGTTTTGGAGTAGGACTTTTGGAGCTGTTATTGGGAAGGCGGCCTGTAGAA
AAGGAGGCAGCCACTGAATGTCAGTCTATAGTGACATGGGCCATGCCTCACCTGACAGATAGATCAAAGCTTCCAAACATTGTTGATCCT
GTCATACAAAACACAATGGATTTAAAGCATTTGTATCAGGTTGCTGCAGTTGCTXCTATTATGTGTTCAGCCAGAGCCAAGCTATCGTCC
GCTAATAACCGATGTATTACATTCCTTAATGTCCCCTTTTACCACACAATTGGTGGGGACGCTTACCGCCTTCTTAACTGCTTGATCAAT
CCCAATTATTGTATGCCTCTCGGCCTTACACAATTTTTTGGCTATTTTTTTAATTTATTTAATACCAACCCGGACTCATTAAAACCATGT
GGGTAA
Edits in Original Sequence 
GCGTGGATCATCATTAACTTGGCATCGCAGGATAAAAATTGCCCTTGATGCAGCAAGGTAGACAGGCTAGACCATTTATTAATTTGAATG
ATTCATGATTCATGATTCATGACATTTGATATTTAACAAATTTGTACCTACAGAGGAATAGAATATTTACATGAGCAGCGCCATCCCCCT
GTAATTCATAGAGATCTGAAATCATCTAATATTCTTTTAGATTCCAACTTCAATGCAAAGGTAAAACTTTTTATGTAGAAATTATACTAG
GACTAGTTTTCCCTCTATTAATCTTGTGTTGTGATTAATTTTAGCTGTCAGATTTTGGTCTTGCTGTGTTGAGTGGGGCTCAAAACAAAA
ACAATATCAAGCTTTCTGGAACTATAGGTTATGTAGCGCCTGAATACATGTTAGATGGAAAATTAAGTGATAAAAGTGATGTTTATGGTT
TTGGAGTAGGACTTTTGGA
(5')ATGTTAGATGGAAAATTAAGTGATAAAAGTGATGTTTATGGTTTTGGAGTAGGACTTTTGGAGCTGT
TATTGGGAAGGCGGCCTGTAGAAAAGGAGGCAGCCACTGAATGTCAGTCTATAGTGACATGGGCCATGCCTCACCTGACAGATAGATCAA
AGCTTCCAAACATTGTTGATCCTGTCATACAAAACACAATGGATTTAAAGCATTTGTATCAGGTTGCTGCAGTTGCTXCTATTATGTGTT
CAGCCAGAGCCAAGCTATCGTCCGCTAATAACCGATGTATTACATTCCTTAATGTCCCCTTTTACCACACAATTaGGTGGGGACGCTTAC
CGCCTTCTTAACTGCTTGATCAATCCCAATTATTGTATGCCTCTCGGCCTTACACAATTTTTTGGCTATTTTTTTAATTTATTTAATACC
AACCCGGACTCATTAAAACCATGTGGGTAA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan