ESTScan Details for Unigene SGN-U336791

Score 
-295
Direction 
Reverse
Predicted Peptide Sequence 
TGEGFGWPPKGPKSWEGEGVLTPEXLKNYLKRRGGYEEKAAPRFPERGEQAGQVIPKAARVRNRESATRGAFRGKTPGIFIVLSGFATFD
WSVDFRDARQGGGAYGKTPATAAFLRFLAFWWPFAHMFFPALSPDSVDNRITPLSELIPLAAAERPSAAESVSEEAEERPIRKPPLPAVG
RFINAAGTTGFPTGKRAVSATQLMELAHSLGTPGFTLYDSDRMLCGIVTDNNFSQETAXDHDYAKLEINPH
Predicted Coding Sequence 
XTAACAGGAGAGGGTTTTGGGTGGCCCCCCAAAGGCCCCAAGTCTTGGGAAGGGGAAGGGGTCCTTACCCCCGAAAAXTTGAAGAATTAC
CTTAAAAGGCGTGGAGGTTATGAAGAAAAGGCXGCCCCCCGCTTCCCCGAAAGGGGAGAACAGGCGGGACAGGTTATCCCTAAAGCGGCA
AGGGTTCGGAACAGGGAGAGCGCCACGAGGGGAGCTTTCAGGGGGAAAACGCCTGGTATCTTTATAGTCCTGTCGGGTTTCGCCACCTTT
GACTGGAGCGTGGATTTTCGTGATGCTCGTCAGGGGGGCGGAGCCTATGGAAAAACCCCAGCAACXGCGGCCTTTTTACGGTTCTTGGCC
TTTTGGTGGCCTTTTGCTCACATGTTCTTTCCTGCGTTATCCCCTGATTCTGTGGATAACCGTATTACCCCTTTGAGTGAGCTGATACCG
CTCGCCGCAGCCGAACGACCGAGCGCAGCXGAGTCAGTGAGCGAGGAAGCGGAAGAGCGCCCAATACGCAAACCGCCTCTCCCCGCCGTT
GGCCGATTCATTAATGCAGCTGGCACGACAGGTTTCCCGACTGGAAAGCGGGCAGTGAGCGCAACGCAATTAATGGAGTTAGCTCACTCA
TTAGGCACCCCAGGCTTTACACTTTATGATTCCGATCGTATGTTGTGTGGAATTGTGACGGATAACAATTTCTCACAGGAAACAGCTXAT
GACCATGATTACGCCAAGCTCGAAATTAACCCTCACTAA
Edits in Original Sequence 
(5')XTAACAGGAGAGGGTTTTGGGTGGCCCCCCAAAGGCCCCAAGTCTTGGGAAGGGGAAGGGGTCCTTACCCCCGAAAAXTTGAAGAA
TTACCTTAAAAGGCGTGGAGGTTATGAAGAAAAGGCXGCCCCCCGCTTCCCCGAAAGGGGAGAACAGGCGGGACAGGTTATCCCgTAAAG
CGGCAAGGGTTCGGAACAGGGAGAGCGCCACGAGGGGAGCTTTCAGGGGGAAAACGCCTGGTATCTTTATAGTCCTGTCGGGTTTCGCCA
CCTTTGACTGGAGCGTGGATTTTCGTGATGCTCGTCAGGGGGGCGGAGCCTATGGAAAAACCCCAGCAACXGCGGCCTTTTTACGGTTCT
TGGCCTTTTGGTGGCCTTTTGCTCACATGTTCTTTCCTGCGTTATCCCCTGATTCTGTGGATAACCGTATTACCgCCTTTGAGTGAGCTG
ATACCGCTCGCCGCAGCCGAACGACCGAGCGCAGCXGAGTCAGTGAGCGAGGAAGCGGAAGAGCGCCCAATACGCAAACCGCCTCTCCCC
GCgCGTTGGCCGATTCATTAATGCAGCTGGCACGACAGGTTTCCCGACTGGAAAGCGGGCAGTGAGCGCAACGCAATTAATGtGAGTTAG
CTCACTCATTAGGCACCCCAGGCTTTACACTTTATGATTCCgGATCGTATGTTGTGTGGAATTGTGAgCGGATAACAATTTCTCACAGGA
AACAGCTXATGACCATGATTACGCCAAGCTCGAAATTAACCCTCACTAA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan