ESTScan Details for Unigene SGN-U336799

Score 
255
Direction 
Forward
Predicted Peptide Sequence 
MENQKEANXVAMGKNHFVYDHNSLCWRDTKILTVDXERQVFDVASKVNCLCNCNAEVCMKYQLPGEDLDALVSLIDDDDVEQMMVEYDRM
QKVSNKPARLRLFLFYPIRLPESPLNPDFLFGFDKDYNPNPSPTATEDLLQLQFPENSGLDMSKNEGSGVIAVPKNICGDSSSNSLLVEN
HYTQXVRERHVDGGTYCNAGANGLRGPLINVGYTPGLAIWIMAAGGGNHDPLFPIGP
Predicted Coding Sequence 
ATGGAGAATCAAAAGGAAGCTAATGXTGTAGCTATGGGGAAAAATCACTTCGTCTACGATCATAACTCTCTATGTTGGCGGGATACCAAA
ATCCTCACTGTTGATCXGGAACGTCAAGTTTTCGATGTTGCTTCAAAGGTGAATTGTCTCTGTAATTGCAACGCGGAGGTTTGTATGAAG
TATCAGTTGCCTGGCGAAGATCTCGATGCACTGGTTTCTCTTATCGATGATGACGATGTTGAGCAAATGATGGTTGAATATGATCGCATG
CAGAAAGTTTCGAATAAACCGGCTAGGTTAAGGCTTTTCCTCTTTTACCCGATTCGCTTACCAGAATCGCCGTTGAATCCGGATTTTTTA
TTCGGATTCGATAAGGATTACAACCCGAACCCGAGTCCAACGGCAACAGAGGATCTTCTCCAATTGCAATTCCCCGAAAATTCAGGATTA
GATATGTCAAAAAATGAAGGAAGCGGCGTGATTGCAGTTCCGAAAAATATTTGTGGTGACAGCAGCAGCAACAGCTTGTTGGTGGAGAAT
CATTACACACAANGGGTACGTGAAAGGCACGTTGATGGTGGGACCTATTGTAATGCXGGTGCAAATGGTTTACGGGGTCCACTGATTAAT
GTGGGGTATACCCCTGGTTTGGCAATTTGGATAATGGCTGCAGGTGGGGGCAATCATGACCCACTTTTTCCAATTGGGCCC
Edits in Original Sequence 
AATTCGCACGAGGCTTTCCTTATTCTCGCTTGAATTTGGCGGCGGCGCGCGCAATGGAGAATCAAAAGGTAAGCTAATGTGTAGCTATGG
GGAAAAATCACTTCGTCTACGATCA
(5')ATGGAGAATCAAAAGGtAAGCTAATGXTGTAGCTATGGGGAAAAATCACTTCGTCTACGAT
CATAACTCTCTATGTTGGCGGGATACCAAAATCCTCACTGTTGATCXGGAACGTCAAGTTTTCGATGTTGCTTCAAAGGTGAATTGTCTC
TGTAATTGCAACGCGGAGGTTTGTATGAAGTATCAGTTGCCTGGCGAAGATCTCGATGCACTGGTTTCTCTTATCGATGATGACGATGTT
GAGCAAATGATGGTTGAATATGATCGCATGCAGAAAGTTTCGAATAAACCGGCTAGGTTAAGGCTTTTCCTCTTTTACCCGATTCGCTTA
CCAGAATCGCCGTTGAATCCGGATTTTTTATTCGGATTCGATAAGGATTACAACCCGAACCCGAGTCCAACGGCAACAGAGGATCTTCTC
CAATTGCAATTCCCCGAAAATTCAGGATTAGATATGTCAAAAAATGAAGGAAGCGGCGTGATTGCAGTTCCGAAAAATATTTGTGGTGAC
AGCAGCAGCAACAGCTTGTTGGTGGAGAATCATTACACACAANGGGTACGTGAAAGGCACGTTGATGGTGGGACCTATTGTAATGCXGGT
GCAAATGGTTTACGGGGTCCACTGATTAATGTGGGGTATACCCCTGGTTTGGCAATTTGGATAATGGCTGCAGGTGGGGGCAATCATGAC
CCACTTTTTCCAATTGGGCCC(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan