ESTScan Details for Unigene SGN-U336907

Score 
361
Direction 
Forward
Predicted Peptide Sequence 
MDSNAHHVACNSLDYDPDLQHLPVFAVSSSLFKSLNSTFYGRELTFDSLAKFFVSYQHFTFYPIIRAFRVNMVVQTLLLLFSXKKLPDRF
LNILGIMVFWTWFSLLVPLLANWTERVLFALTSFAGPGFNTVKSVLNHYGADAYVGQPLGNDWDRETNTQDYCHWMVLLKGMVLARIRLP
T
Predicted Coding Sequence 
ATGGACTCTAATGCTCATCATGTGGCTTGTAATAGCTTGGATTATGATCCTGATCTTCAGCACTTGCCAGTTTTTGCTGTATCTTCAAGC
CTGTTTAAGTCATTGAATTCTACTTTCTATGGAAGAGAGTTAACATTCGATTCCCTTGCGAAGTTCTTTGTTAGCTATCAACATTTTACT
TTTTATCCAATCATTCGTGCTTTCAGGGTGAATATGGTTGTACAGACATTGTTGTTGTTGTTCTCTAAXAAGAAATTGCCTGATAGATTT
TTGAACATATTGGGAATCATGGTTTTCTGGACTTGGTTTTCACTTCTTGTGCCTCTCCTTGCCAATTGGACAGAGAGGGTGTTGTTTGCC
CTCACAAGCTTTGCTGGACCGGGATTCAACACAGTCAAGTCCGTTTTGAATCATTATGGTGCTGATGCTTATGTTGGACAGCCCTTAGGG
AACGATTGGGATCGAGAAACAAACACCCAGGACTATTGCCATTGGATGGTTCTCCTCAAAGGGATGGTTCTTGCGAGGATTCGCCTTCCA
ACTTGA
Edits in Original Sequence 
CTTGATTCATATGCTTTCTGGAGGATTATTGGGGTTAACTTGGATGCAGATATCTTATTTGGGTCATGATTCTGGTCATTACTTGATTAT
GACAAATAAGGGTTTCAATAAAATGGTACAGATTATGTCTGGGAATTGACTTACTGGGATTAGTATTGCTTGGTGGAAATGGACTCATAA
TGCTCATCATGTGGCTTGTAATAGCTTGGATTATGATCCTGATCTTCAGCACTTGCCA
(5')ATGGACTCaTAATGCTCATCATGTGGCT
TGTAATAGCTTGGATTATGATCCTGATCTTCAGCACTTGCCAGTTTTTGCTGTATCTTCAAGCCTGTTTAAGTCATTGAATTCTACTTTC
TATGGAAGAGAGTTAACATTCGATTCCCTTGCGAAGTTCTTTGTTAGCTATCAACATTTTACTTTTTATCCAATCATTCGTGCTTTCAGG
GTGAATATGGTTGTACAGACATTGTTGTTGTTGTTCTCTAAXAAGAAATTGCCTGATAGATTTTTGAACATATTGGGAATCATGGTTTTC
TGGACTTGGTTTTCACTTCTTGTGCCTCTCCTTGCCtAATTGGACAGAGAGGGTGTTGTTTGCCCTCACAAGCTTTGCTGtGACCGGGAT
TCAACACAGTCAAGTCCGTTTTGAATCATTATGGTGCTGATGCTTATGTTGGACAGCCCTTAGGGAACGATTGGGATCGAGAAACAAACA
CCCAGGACTATTGCCATTGGATGGTTCTCCTCAAAGGGATGGTTCTTGCGAGGATTCGCCTTCCAACTTGA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan