ESTScan Details for Unigene SGN-U336933

Score 
257
Direction 
Forward
Predicted Peptide Sequence 
MASRCSRIISKASLSSIRSAMKLNSQSASSATSSPVSLLQPDLLRLLSAGYPFQEXPSELGGVQSMLPLHNAVATAXDDVMPELNIEELQ
SSFTGAGSISTEVTLLAXLLEKAVNSLMEMQDFVVGKAVLFNDSNFIRAVTIFDCIELSSVSLITRKFTXGIILASFVFWADFQLKMDEV
HLYNKDILFFHXXXXXXXXXXXXXGGPXYPIRPIGSRITFTGPSFTRRDXEKPGVTQLIACSNPPFAAGV
Predicted Coding Sequence 
ATGGCTTCAAGGTGTAGCAGAATTATCAGCAAGGCTTCGCTTTCTTCTATCAGATCCGCCATGAAGCTCAATTCTCAATCAGCTTCTTCT
GCGACGTCTTCTCCAGTTTCTCTGCTTCAACCAGATCTGCTTCGTCTCCTCTCCGCCGGTTATCCTTTTCAAGAAXTTCCGTCGGAGCTG
GGAGGAGTGCAGTCAATGTTGCCACTACACAATGCAGTTGCTACGGCGAXGGATGACGTCATGCCTGAGCTCAACATCGAGGAGTTGCAG
AGCTCTTTCACAGGAGCTGGGTCTATCAGTACCGAGGTGACTTTGTTAGCAGAXTTGTTAGAGAAAGCTGTCAACTCTTTGATGGAAATG
CAAGATTTTGTCGTAGGCAAGGCAGTTCTGTTTAATGACTCAAACTTTATAAGGGCGGTAACAATATTTGATTGTATTGAACTGAGTTCT
GTTTCCTTGATTACTAGGAAATTTACTXATGGAATAATTCTTGCTTCCTTCGTTTTTTGGGCCGATTTTCAACTGAAAATGGATGAGGTT
CATTTGTATAACAAAGATATCTTGTTTTTCCATNNNNNNNNNNNNNNNNNNNNNNNNAANNAAAANNNANNGGGGGGGCCCGXGTACCCA
ATTCGCCCTATAGGGAGTCGTATTACATTCACTGGGCCGTCGTTTACACGTCGTGACXTGGAAAAACCTGGCGTTACCCAACTAATCGCC
TGCAGCAATCCCCCTTTCGCAGCTGGCGTATAA
Edits in Original Sequence 
GCATAGCTCCGAGATATTCACCCAAAACTCTCCGTACAATGGCTTCAAGGTGTAGCAGAATTATCAGCAAGGCTTCGCTTTCTTCTATCA
GATCCGCCATGAAGCTCAATTCT
(5')ATGGCTTCAAGGTGTAGCAGAATTATCAGCAAGGCTTCGCTTTCTTCTATCAGATCCGCCATG
AAGCTCAATTCTCAATCAGCTTCTTCTGCGACGTCgTTCTCCAGTTTCTCTGCTTCAACCAGATCTGCTTCGTCTCCTCTCCGCCGGTTA
TCCTTTTCAAGAAXTTCCGTCGGAGCTGGGAGGAGTGCAGTCAATGTTGCCACTACACAATGCAGTTGCTACGGCGAXGGATGACGTCAT
GCCTGAGCTCAACATCGAGGAGTTGCAGAGCTCTTTCACAGGAGCTGGGTCTATCAGTACCGAGGTGACTTTGTTAGCAGAXTTGTTAGA
GAAAGCTGTCAACTCTTTGATGGAAATGCAAGATTTTGTCGTAGGCAAGGCAGTTCTGTTTAATGACTCAAACTTTATAAGGGCGGTAAC
AATATTTGATTGTATTGAACTGAGTTCTGTTTCCTTGATTACTAGGAAATTTACTXATGGAATAATTCTTGCTTCCTTCGTTTTTTGGGC
CGATTTTCAtACTGAAAATGGATGAGGTTCATTTGTATAACAAAGATATCTTGTTTTTCCATNNNNNNNNNNNNNNNNNNNNNNNNAANN
AAAANNNANNGGGGGGGCCCGXGTACCCAATTCGCCCTATAGGGAGTCGTATTACATTCACTGGGCCGTCGTTTACACGTCGTGACXTGG
AAAAACCTGGCGTTACCCAACTAATCGCCTGCAGCAATCCCCCTTTCGCAGCTGGCGTATAA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan