ESTScan Details for Unigene SGN-U336976

Score 
430
Direction 
Forward
Predicted Peptide Sequence 
GRGXLKNTGAQRWSSTAVAAAXRTSGSPGLQVILLAKPSVSGAKRKAVTPPVDVASQPPFFSVPNKNGKEDWSCALCQVSATCERGLNDH
LQGKKHKSKEAALREQRFGKNYSIGLFPKKPKINNLSEADGNVNMERMVKPQGEXVGSQQIKGKMISINFGEESAEDTITLTLHHNADDS
KKSAYAGPNKQNAGKKYKFWCATCKVWALSEVSLDAHRVGGSIMLRYWCSAELVLHLTKLRAAYTVNEALRDAGETVAVWLITLRLVMKL
INGSEKPMLLKMESTPSX
Predicted Coding Sequence 
XGGGGAAGGGGGNNNTTGAAAAACACTGGTGCACAACGCTGGAGCTCCACCGCGGTGGCGGCCGCTXCTAGAACTAGTGGATCCCCCGGG
CTGCAGGTCATCTTGCTGGCTAAGCCTAGTGTCTCTGGAGCAAAACGAAAAGCTGTTACACCACCAGTGGATGTTGCCAGCCAGCCTCCG
TTTTTCAGTGTTCCAAACAAAAATGGGAAAGAGGACTGGAGTTGTGCACTTTGCCAGGTAAGTGCGACTTGTGAGCGTGGACTGAATGAT
CACCTCCAAGGAAAGAAACACAAGTCCAAGGAAGCTGCTTTGCGAGAACAGAGGTTCGGTAAGAACTACAGCATCGGTCTTTTTCCAAAG
AAACCTAAGATTAACAACCTTTCAGAAGCCGATGGCAATGTTAACATGGAGCGAATGGTAAAACCACAGGGTGAAXTTGTTGGTTCACAA
CAAATCAAGGGAAAGATGATCTCTATTAATTTTGGAGAAGAAAGTGCCGAGGACACCATCACCCTAACTCTGCATCACAATGCTGATGAC
TCGAAGAAAAGTGCATATGCAGGTCCAAACAAGCAGAATGCTGGGAAGAAGTACAAATTTTGGTGCGCAACGTGCAAAGTATGGGCTCTG
TCTGAGGTGTCATTGGACGCACACAGGGTTGGAGGAAGCATAATGCTTCGTTACTGGTGCTCAGCAGAGCTTGTGCTTCACCTGACAAAG
CTGAGAGCAGCTTATACTGTTAATGAAGCATTAAGAGATGCAGGGGAAACTGTAGCTGTTTGGTTGATAACACTTAGACTGGTTATGAAG
CTTATTAATGGGTCCGAGAAACCGATGCTGCTAAAAATGGAAAGCACTCCATCTGXX
Edits in Original Sequence 
(5')XGGGGAAGGGGGNNNTTGAAAAACACTGGTGCACAACGCTGGAGCTCCACCGCGGTGGCGGCCGCTXCTAGAACTAGTGGATCCCC
CGGGCTGCAGGTCATCTTGCTGGCTAAGCCTAGTGTCTCTGGAGCAAAACGAAAAGCTGTTACACCACCAGTGGATGTTGCCAGCCAGCC
TCCGTTTTTCAGTGTTCCAAACAAAAATGGGAAAGAGGACTGGAGTTGTGCACTTTGCCAGGTAAGTGCGACTTGTGAGCGTGGACTGAA
TGATCACCTCCAAGGAAAGAAACACAAGTCCAAGGAAGCTGCTTTGCGAGAACAGAGGTTCGGTAAGAACTACAGCATCGGTCTTTTTCC
AAAGAAACCTAAGATTAACAACCTTTCAGAAGCCGATGGCAATGTTAACATGGAGCGAATGGTAAAACCACAGGGTGAAXTTGTTGGTTC
ACAACAAATCAAGGGAAAGATGATCTCTATTAATTTTGGAGaAAGAAAGTGCCGAGGACACCATCACCCTAACTCTGCATCACAATGCTG
ATGACTCGAAGAAAAGTGCATATGCAGGTCCAAACAAGCAGAATGCTGGGAAGAAGTACAAATTTTGGTGCGCAACGTGCAAAGTATGGG
CTCTGTCTGAGGTGTCATTGGACGCACACAGGGTTgGGAGGAAGCATAATGCTTCGTTACTGGTGCTCAGCAGAGCTTGTGCTTCACCTG
ACAAAGCTGAGAGCAGCTTATACTGTTAATGAAGCATTAAGAGATGtCAGGGGAAACTGTAGCTGTTTaGGTTGATAACACTTAGACTGG
TTATGAAGCaTTATTAATGGGTCCGAGAAACCGATGCTGCTAAAAATGGAAAGCACTCCATCTGXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan