ESTScan Details for Unigene SGN-U337007

Score 
580
Direction 
Forward
Predicted Peptide Sequence 
MTNFTMEEYEFLKELGIGPQNLGCYVNGTWKATGPVISTVNPASNQIIAEVYEASARDYEEGMSACAEAAKIWVQVPAPKRGEIVRQIGD
ALRANLQQFGRLVSLEMGKILPEGIGEVQEVIDMCDFAVGLSRQLNGSIIPSERPNHMMLETWNPLGIVGVITAFNFPCAVLGKPLRFLI
Predicted Coding Sequence 
ATGACTAATTTCACGATGGAAGAGTACGAGTTCCTCAAAGAGCTAGGAATTGGTCCCCAAAATCTCGGTTGTTATGTTAATGGCACCTGG
AAAGCTACTGGCCCCGTCATTTCCACTGTTAATCCTGCTAGCAACCAGATCATTGCCGAAGTTTACGAAGCTTCTGCTCGAGATTATGAG
GAAGGCATGTCAGCTTGCGCTGAAGCAGCTAAGATTTGGGTGCAGGTTCCTGCACCAAAAAGAGGAGAGATTGTTAGACAGATAGGTGAT
GCACTCCGGGCGAACCTTCAGCAATTTGGTCGACTTGTTTCACTTGAAATGGGAAAGATACTCCCAGAAGGAATTGGGGAGGTTCAAGAA
GTCATTGATATGTGTGATTTTGCTGTGGGATTGAGTCGACAACTGAATGGATCCATTATTCCTTCTGAACGCCCTAACCACATGATGTTG
GAGACGTGGAATCCGCTCGGGATAGTTGGTGTAATCACGGCTTTCAACTTCCCATGTGCTGTACTTGGTAAGCCATTGAGATTTTTGATA
TGA
Edits in Original Sequence 
GGTGACTCGACACTTCTCTTTCCCTACGTCTCTTCTACTACTATTTCATCCACTGGGTTGAATCGCCACTTCTATAGCATTCTCATTGAG
TCTAACTTTGTGTGAAATCATGACTAATTTCACGATGGAAGAGTACGAGTTCCTCAAAGAGCTAGGAATTGGTCCCCAAAAT
(5')ATGA
CTAATTTCACGATGGAAGAGTACGAGTTCCTCAAAGAGCTAGGAATTGGTCCCCAAAATCTCGGTTGTTATGTTAATGGCACCTGGAAAG
CTACTGGCCCCGTCATTTCCACTGTTAATCCTGCTAGCAACCAGATCATTGCCGAAGTTTACGAAGCTTCTGCTCGAGATTATGAGGAAG
GCATGTCAGCTTGCGCTGAAGCAGCTAAGATTTGGGTGCAGGTTCCTGCACCAAAAAGAGGAGAGATTGTTAGACAGATAGGTGATGCAC
TCCGGGCGAACCTTCAGCAATTTGGTCGACTTGTTTCACTTGAAATGGGAAAGATACTCCCAGAAGGAATTGGGGAGGTTCAAGAAGTCA
TTGATATGTGTGATTTTGCTGTGGGATTGAGTCGACAACTGAATGGATCCATTATTCCTTCTGAACGCCCTAACCACATGATGTTGGAGA
CGTGGAATCCGCTCGGGATAGTTGGTGTAATCACGGCTTTCAACTTCCCATGTGCTGTACTTGGTAAGCCATTGAGATTTTTGATATGA
(3')TGGTCAATTTACAAGAATAATGTCCAATACAACAGAACTACCTATCATCATTCAAGAATTGAGTCCCTGAATTTTTCTCTCCTCTTC
CTTTGATATTTATAATTTTGTTGGTACACAACTTCGCTCTATTCTGATAAAACTGTGCTTTTACATGATGCCTATGTG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan