ESTScan Details for Unigene SGN-U337015

Score 
387
Direction 
Forward
Predicted Peptide Sequence 
KAGAPRGGGRSRTSGSPGLQEFGXEAKFETEYREVLTQFTEMTSRYAQEMQAIDELLKHRNEIHASYTTLPVMKRSSSSSNRSKNKSGSK
GASEDGSIKEKKPLRKRTKKKKWVHIPLKVDQKKAVVIKVIXKTPELNXIIAEVHFSFNPSNQPIGGIPEFLPRDFLGGTKDHYWPEIMV
ILWNGGYTGSTPKILSSNAPHVNWIIPSPGLPEWAMPGCGFKGEKKVGLLVGPNENLIQRVKDT
Predicted Coding Sequence 
AAAGCTGGAGCTCCCCGCGGTGGCGGCCGCTCTAGAACTAGTGGATCCCCCGGGCTGCAGGAATTCGGCXACGAGGCTAAGTTTGAAACA
GAATATAGGGAGGTCTTAACACAATTTACTGAGATGACAAGTAGATATGCTCAAGAAATGCAAGCTATTGATGAGCTTCTTAAGCACCGC
AATGAAATTCATGCTTCCTATACAACTCTTCCCGTGATGAAACGTAGTAGTAGCAGCAGCAATCGAAGTAAGAACAAAAGTGGATCCAAG
GGAGCCAGTGAAGATGGCTCAATAAAAGAAAAGAAGCCTTTAAGAAAACGGACAAAGAAAAAGAAATGGGTCCACATTCCCTTAAAAGTT
GACCAGAAGAAAGCXGTGGTAATTAAGGTTATAAAXAAAACACCGGAACTGAATGAXATAATTGCGGAAGTACACTTTTCTTTTAATCCC
AGCAACCAACCTATTGGAGGAATTCCAGAATTCCTTCCAAGGGACTTCCTTGGAGGAACTAAGGATCACTATTGGCCTGAAATAATGGTA
ATTTTATGGAATGGTGGTTACACCGGAAGCACACCAAAAATTCTTTCCTCCAACGCTCCACATGTAAATTGGATTATTCCATCACCAGGC
CTTCCTGAATGGGCCATGCCTGGGTGTGGTTTTAAGGGGGAAAAAAAGGTGGGACTTTTGGTAGGTCCGAACGAGAACTTAATTCAAAGA
GTGAAGGATACATAA
Edits in Original Sequence 
(5')AAAGCTGGAGCTCCCCGCGGTGGCGGCCGCTCTAGAACTAGTGGATCCCCCGGGCTGCAGGAATTCGGCXACGAGGCTAAGTTTGA
AACAGAATATAGGGAGGTCTTAACACAATTTACTGAGATGACAAGTAGATATGCTCAAGAAATGCAAGCTATTGATGAGCTTCTTAAGCA
CCGCAATGAAATTCATGCTTCCTATACAACTCTTCCCGTGATGAAACGTAGTAGTAGCAGCAGCAATCGAAGTAAGAACAAAAGTGGATC
CAAGGGAGCCAGTGAAGATGGCTCAATAAAAGAAAAGAAGCCTTTAAGAAAACGGACAAAGAAAAAGAAATGGGTCCACATTCCCTTAAA
AGTTGACCAGAAGAAAGCXGTGGTAATTAAGGTTATAAAXAAAACACCGGAACTGAATGAXATAATTGCGGAAGTACACTTTTCTTTTAA
TCCCAGCAACCAACCTATTGGAGGAATTCCAGAATTCCTTCCAAGGGACTTCCTTGGAGGAACTAAGGATCACTATTGGCCTGAAATAAT
GGTAATTTTATGGAATGGTGGTTACACCGGAAGCACACCAAAAATTCTTTCCTCCAACGCTCaCACATGTAAATTGGATTATTCCATCAC
CAGGCCTTCCTGAATGGGCCATGCCTGGGTGTGGTTTTAAGGGGGAAAAAAAGGTGGGACTTTTGGTAGGTCCGAACGAGAACTTAATTC
AAAGAGTGAAGGATACATAA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan