ESTScan Details for Unigene SGN-U337035

Score 
88
Direction 
Forward
Predicted Peptide Sequence 
MATVPSYFHAYNNCFPLKKNIPPAQFXHKASDPIPAAGGSTSSKPAATPVELQLLFPLGRVNFNLGLIKVITVSCVKLFPLPIPHNIRPG
SIKCKAWGALMSDLTHINCVALTARFPVRKPVVPAAINESANSRGEAVCLLGALPLPRSLTAALGRSAAGRGISSLTGGNNGSPKNHGKK
REKKMVSKKAKRRPGNR
Predicted Coding Sequence 
ATGGCCACCGTCCCTTCATACTTCCATGCATACAACAACTGCTTCCCTTTAAAAAAAAACATCCCTCCTGCCCAATTCCXGCACAAGGCC
TCGGACCCAATTCCTGCAGCCGGGGGATCCACTAGTTCAAAACCGGCCGCCACCCCGGTGGAGCTCCAGCTTTTGTTCCCTTTAGGGAGG
GTTAATTTCAACCTTGGCCTAATCAAGGTCATAACTGTTTCCTGTGTGAAATTGTTTCCGCTCCCAATTCCACACAACATACGACCCGGA
AGCATAAAGTGTAAAGCCTGGGGTGCXCTAATGAGTGACCTAACTCACATTAATTGCGTTGCGCTCACTGCCCGCTTTCCAGTCAGGAAA
CCTGTCGTGCCAGCTGCXATTAATGAATCGGCCAACTCTCGGGGAGAGGCGGTTTGCCTATTGGGCGCTCTTCCGCTTCCTCGCTCACTG
ACTGCTGCACTCGGTCGTTCTGCTGCGGGGAGGGGAATCAGCTCACTCACAGGCGGTAATAATGGTTCTCCCAAAAATCATGGGAAAAAG
CGGGAAAAAAAAATGGTGAGCAAAAAGGCCAAACGAAGGCCTGGAAACCGTTAA
Edits in Original Sequence 
TTTTTTTTTTTTTTTATGAAGCCTATACCAGAACCAAATACCCTTTGTGATTTTCCAGAACTAAATAATATAATTTCTTACCCTTTCAAA
TTTTGATATGGACTATTTACCTCTCATCCTCCTATACTAAAGGTGATGGAAAAAGTTATTGATTTTATCCCCCACCCATCCTAAAATTAA
AAATTATCCCTTAATGCTTGTACCAAATGAGCCCTTAATAACAAGTTTCAAAATTTCATACAAAATATACAATTAAATAACTACACCAAT
ATAAGCATCCACTTCCCTTGGAAATTCAAATAAAGATGAAACACACATTGAAGGCATTTATGCAACAGGAACTTTGCCACAAATATCAAA
AATATCTTCCATAGGAGCATGGCCACCGGTCCCTTCATACTTCCATGCATACAAC
(5')ATGGCCACCgGTCCCTTCATACTTCCATGCA
TACAACAACTGCTTCCCTTTAAAAAAAAACATCCCTCCTGCCCAATTCCXGCACAAGGCCTCGGACCCAATTCCTGCAGaCCGGGGGATC
CACTAGTTCAAAACCGGCCGCCACCCCGGTGGAGCTCCAGCTTTTGTTCCCTTTAGGGAGGGTTAATTTCAACCTTGGCCTAATCAAGGT
CATAACTGTTTCCTGTGTGAAATTGTTaTCCGCTCCCAATTCCACACAACATACGACCCGGAAGCATAAAGTGTAAAGCCTGGGGTGCXC
TAATGAGTGACCTAACTCACATTAATTGCGTTGCGCTCACTGCCCGCTTTCCAGTCAGGAAACCTGTCGTGCCAGCTGCXATTAATGAAT
CGGCCAACTCTCGGGGAGAGGCGGTTTGCCTATTGGGCGCTCTTCCGCTTCCTCGCTCACTGACTcGCTGCACTCGGTCGTTCTGCTGCG
GGGAGGGGAATCAGCTCACTCACAGGCGGTAATAATGGTTCTCCCAAAAATCATGGGAAAAAGCGGGAAAAAAAAATGGTGAGCAAAAAG
GCCAAACGAAGGCCTGGAAACCGTTAA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan