ESTScan Details for Unigene SGN-U337042

Score 
349
Direction 
Forward
Predicted Peptide Sequence 
MATDFKFIPLIDVSPLLEKWDHPNITQDEGVAQVVRQLDQACREAGFFYVVMLLCLLIFVFMDFIGGLGNSLLKKEVQDCVKPLCDPALV
GPVYKRVLSALGDLDXQPNFWFYPICNFGEIVAVTEKEAKLXTKFKLDLSYKSIDCCRISVHLISTGVCSAILQKGHGIPDFLXEDIKAX
AREYFHQPYEEKIQIKLSAETGYRGYQRIGEKCTXGVPDXHGAIGWYREVTHGMX
Predicted Coding Sequence 
ATGGCTACAGATTTCAAGTTTATCCCTCTTATAGATGTGAGTCCTCTTTTGGAGAAGTGGGATCATCCAAATATTACTCAAGATGAAGGT
GTAGCTCAAGTTGTTAGGCAATTAGATCAGGCTTGTAGAGAAGCTGGATTCTTTTATGTGGTAATGCTTCTTTGCCTTCTAATATTTGTA
TTTATGGATTTTATTGGTGGCCTTGGAAATAGCCTCTTGAAAAAGGAAGTGCAAGACTGCGTTAAACCCTTGTGTGATCCGGCCCTTGTT
GGACCTGTGTATAAACGGGTGCTAAGTGCCCTTGGCGATCTTGATXTGCAGCCTAATTTTTGGTTTTATCCAATTTGCAATTTTGGGGAA
ATAGTTGCTGTCACTGAGAAAGAAGCTAAGCTTXTTACTAAGTTTAAGTTGGATCTTTCATATAAATCAATTGATTGTTGTAGGATTAGT
GTCCATTTGATCTCTACTGGTGTTTGTTCTGCAATCTTGCAGAAGGGCCATGGTATTCCTGATTTCCTTATNGAAGATATTAAAGCAXTA
GCACGCGAATATTTTCATCAACCGTATGAAGAGAAAATTCAGATCAAACTCTCTGCAGAAACTGGATACAGAGGATACCAAAGAATTGGA
GAGAAATGTACCAANGGCGTACCTGATNAACATGGAGCTATTGGATGGTATAGAGAAGTGACTCATGGGATGNATTGA
Edits in Original Sequence 
GGACTGGCAGAATTAATAGATTCCAAACTGCATATTCTAGCGAACTAAGAAGAAGAAACACAGAAAACTGGAAGCACCATGGCTACAGAT
TTCAAGTTTATCCCTCTTATAGATGTGAGTCCTCTTTTGGAGAAGTGGGATCATCCAAATAT
(5')ATGGCTACAGATTTCAAGTTTATC
CCTCTTATAGATGTGAGTCCTCTTTTGGAGAAGTGGGATCATCCAAATATTACTCAAGATGAAGGTGTAGCTCAAGTTGTTAGGCAATTA
GATCAGGCTTGTAGAGAAGCTGGATTCTTTTATGTGGTAATGCTTCTTTaGCCTTCTAATATTTGTATTTATGGATTTTATTGGTGGCCT
TGGAAATAGCCTCTTGtAAAAAGGAAGTGCAAGACTGCGTTAAACCCTTGTGTGATCCGGCCCTTGTTGGACCTGTGTATAAACGGGTGC
TAAGTGCCCTTGGCGATCTTGATXTGCAGCCTAATTTTTGGTTTTATCCAATTTGCAATTTTGGGGAAATAGTgTGCTGTCACTGAGAAA
GAAGCTAAGCTTXTTACTAAGTTTAAGTTGGATCTTTCATATAAATCAATTGATTGTTGTAGGATTAGTGTCCATTTGATCTCTACTGGT
GTTTGTTCTGCAATCTTGCAGAAGGGCCATGGTATTCCTGATTTCCTTATNGAAGATATTAAAGCAXTAGCACGCGAATATTTTCATCAA
CCGTATGAAGAGAAAATTCAGATCAAACTCTCTGCAGAAACTGGATACAGAGGATACCAAAGAATTGGAGAGAAATGTACCAANGGCGTA
CCTGATNAACATGGAGCTATTGGATGGTATAGAGAAGTGACTCATGGGATGNATTGA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan