ESTScan Details for Unigene SGN-U337094

Score 
-285
Direction 
Reverse
Predicted Peptide Sequence 
FPTLLCPVSGGDLFVGRVRKRGAGGPMGKNGQDKAGPFFRVSGAFLVGPFGLPGFFSRGYPPGFWGVTRYYPPLEGGGIPLPRNPNGPGA
KRVSEPRKRKSPPIANPPLPGGLADSLMQGRARFPDWKAGSERKPINXELAHSLGPPXALHFMVPAGMLCGIVTDNNFTQETAMTMITPS
WKLTLTKGNKSWSSTAVA
Predicted Coding Sequence 
XTGTTCCCCACCCTCTTGTGTCCTGTGAGCGGGGGCGATTTGTTTGTTGGAAGGGTTCGTAAAAGGGGGGCGGGGGGCCCCATGGGAAAG
AACGGCCAAGACAAGGCGGGGCCTTTTTTTAGGGTTTCCGGCGCCTTTTTGGTGGGCCCTTTTGGCCTCCCAGGTTTTTTTTCCCGGGGT
TATCCCCCGGGATTCTGGGGAGTAACCCGGTATTACCCCCCCTTGGAGGGAGGGGGAATCCCGCTTCCCCGCAACCCGAACGGACCCGGG
GCCAAGCGAGTCAGTGAGCCGAGGAAGCGGAAGAGCCCCCCAATCGCAAACCCCCCTCTCCCCGGCGGGTTGGCCGATTCATTAATGCAG
GGCCGCGCCAGGTTTCCCGACTGGAAAGCGGGCAGTGAGCGCAAGCCAATTAATGXTGAGTTAGCTCACTCATTAGGCCCCCCAGXGGCT
TTACACTTTATGGTTCCGGCTGGTATGTTGTGTGGAATTGTGACGGATAACAATTTCACTCAGGAAACAGCTATGACCATGATTACGCCA
AGCTGGAAATTAACCCTCACTAAAGGGAACAAAAGCTGGAGCTCCACCGCGGTGGCG
Edits in Original Sequence 
(5')XTGTTCCCCACCCTCTTGTGTCCTGTGAGCGGGGGCGATTTGTTTGTTGGAAGGGTTCGTAAAAGGGGGGCGGGGGGCCCCATGGG
AAAGAACGGCCAAGACAAGGCGGGGCCTTTTTTTAGGGTTTCCGGCGCCTTTTTGGTGGGCCCTTTTGGCCTCCCAGGTTTTTTTTCCCG
GGGTTATCCCCCGGGATTCTGGGGAGTAACCCGGTATTACCCCCCCTTGGAGGGAGGGGGAATCCCGCTTCCCCGCAACCCGAACGGACC
CGGGGCCAAGCGAGTCAGTGAGCCGAGGAAGCGGAAGAGCCCCCCAATCGCAAACCCCCCTCTCCCCGGCGGGTTGGCCGATTCATTAAT
GCAGGtGCCGCGCCAGGTTTCCCGACTGGAAAGCGGGCAGTGAGCGCAAGCCAATTAATGXTGAGTTAGCTCACTCATTAGGCCCCCCAG
XGGCTTTACACTTTATGGTTCCGGCTGGTATGTTGTGTGGAATTGTGAgCGGATAACAATTTCACTCAGGAAACAGCTATGACCATGATT
ACGCCAAGCTGGAAATTAACCCTCACTAAAGGGAACAAAAGCTGGAGCTCCACCGCGGTGGCG(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan