Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U337119

Score 
72
Direction 
Forward
Predicted Peptide Sequence 
SRXEALKSVXTAGAPPAVAAAXRTSGSPGLQEFGTRLRPGKFPPKAAMVNFKALSVNLLLLVLLCPASAQPSNSPDSENRFEYPSVSPAM
AIIIVILIAALFFIAFLSIYIRNRGAVNGSISQTFFMLRDTAAGTQGLEDSFIKTFATFTYIEMKDHHIGKGAXGVSRVSEEFEDDEMXA
FDPKCDHVFYPECIYAWVKSYVTCPACRTDNLLKPDEPGPFKLLGEPGIVLEQEITLLNTNFRSNTLYENLMSYQX
Predicted Coding Sequence 
XGGTCTAGGNTTGAAGCCTTGAAATCCGTTNACACTGCAGGAGCTCCACCXGCTGTGGCGGCCGCTXCTAGAACTAGTGGATCCCCCGGG
CTGCAGGAATTCGGCACGAGGCTCCGGCCGGGGAAATTCCCACCAAAAGCTGCCATGGTTAATTTTAAAGCTCTTTCCGTTAATCTCCTC
CTATTAGTATTACTATGTCCGGCGTCAGCTCAGCCATCAAATTCCCCTGATTCCGAGAATCGGTTCGAGTACCCGAGTGTCAGTCCTGCT
ATGGCAATTATCATAGTGATACTTATTGCTGCTCTTTTTTTCATTGCCTTCTTATCAATTTACATACGCAACCGCGGTGCAGTTAACGGA
AGCATAAGTCAAACCTTCTTCATGCTACGGGATACTGCTGCTGGTACTCAAGGACTTGAAGATTCCTTCATCAAGACTTTTGCTACCTTT
ACTTACATCGAAATGAAGGATCATCATATTGGGAAGGGAGCTXTTGGAGTGAGCCGTGTGTCTGAAGAATTTGAAGATGATGAAATGXTA
GCGTTCGATCCCAAATGTGATCACGTTTTTTATCCTGAATGCATCTATGCTTGGGTCAAATCTTATGTTACTTGCCCTGCTTGCCGAACT
GATAATCTTCTXAAACCTGATGAACCTGGCCCGTTTAAACTCTTGGGTGAACCGGGAATTGTGCTTGAACAGGAGATTACCCTCCTCAAT
ACTAATTTTCGATCAAATACATTATATGAAAATTTGATGTCCTACCAAGXX
Edits in Original Sequence 
(5')XGGTCTAGGNTTGAAGCCTTGAAATCCGTTNACACTGCAGGAGCTCCACCXGCTGTGGCGGCCGCTXCTAGAACTAGTGGATCCCC
CGGGCTGCAGGAATTCGGCACGAGGCTCCGGCCGGGGAtAATTCCCACCAAAAGCTGCCATGGTTAATTTTAAAGCTCTTTCCGTTAATC
TCCTCCTATTAGTATTACTATGTCCGGCGTCAGCTCAGCCATCAAATTCCCCTGATTCCGAGAATCGGTTCGAGTACCCGAGTGTCAGTC
CTGCTATGGCAATTATCATAGTGATACTTATTGCTGCTCTTTTTTTCATTGCCTTCTTATCAATTTACATACGCAACCGCGGTGCAGTTA
ACGGAAGCATAAGTCAAACCTTCTTCATGCTACGGGATACTGCTGCTGGTACTCAAGGACTTGAAGATTCCTTCATCAAGACTTTTGCTA
CCTTTACTTACATCGAAATGAAGGATCATCATATTGGGAAGGGAGCTXTTGGAGTGAGCCGTGTGTCTGAAcGAATTTGAAGATGATGAA
ATGXTAGCGTTCGATCCCAtAATGTGATCACGTTTTTTATCCTGAATGCATCTATGCTTGGGTCAAATCTTATGTTACTTGCCCTGCTTG
CCGAACTGATAATCTTCTXAAACCTGATGAACCTGGCCCGTTTAAACTCTTGGGTGAACCGGGAATTGTGCTTGAACAGGAGATTACCCT
CCTCAATACTAATTTTCGATCAAATACATTATATGAAAATTTGATGTCCTACCAAGXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan