ESTScan Details for Unigene SGN-U337138

Score 
-266
Direction 
Reverse
Predicted Peptide Sequence 
MGISGFQKWEPPPPTPIWGQFLPELKKGFFPDFXGPFGLKNAPDLTKIFTANFNQNIERLPLCHSAFRAAQLLGTPIGGGLFAITPAGER
GMCCKAIKLGNARVFPVRTLYTDXPVNCNSTHYRANWVPAPPRVIFYFLLNLKHNDIYSSGNVNIQAIVHFIIHSLVTYLYNSQNYDIVT
QIYVTVSPLVRSVVVAAASAEKTLAVNCFLLRLWAIAXSSLMPQMIVWHKLSGHWYILQNPGKTERSTIPLGKSAIXLQQCKPTSSGPLV
IHHYKGLVERILQRLQSVESGCSRTYADQXMHRPLESIXXXXPXPSFP
Predicted Coding Sequence 
ATGGGGATTTCTGGTTTCCAAAAATGGGAACCACCCCCTCCAACCCCAATCTGGGGCCAATTTCTTCCGGAATTAAAAAAGGGGTTTTTC
CCCGATTTTCXGGGCCCTTTTGGTTTAAAAAATGCCCCTGATTTAACCAAAATTTTTACCGCGAATTTTAACCAAAATATTGAACGCCTC
CCATTGTGCCATTCGGCCTTCCGGGCTGCGCAATTGTTGGGAACGCCGATCGGTGGGGGCCTTTTTGCTATTACGCCAGCTGGCGAAAGG
GGAATGTGCTGCAAGGCGATTAAGTTGGGTAACGCCAGGGTTTTCCCAGTCAGGACGTTGTACACCGACGXGCCAGTGAATTGTAATTCG
ACTCACTATAGGGCGAATTGGGTACCGGCCCCCCCTCGAGTAATTTTCTATTTTTTGTTGAACTTAAAACACAATGATATATATTCCTCA
GGCAATGTGAACATACAAGCGATAGTTCATTTTATTATTCATTCACTTGTTACATACTTGTACAACAGTCAAAATTATGACATCGTTACX
CAGATTTATGTAACAGTTTCTCCTCTAGTTCGCTCTGTTGTGGTTGCAGCTGCCTCCGCGGAAAAAACATTAGCTGTTAACTGTTTTCTC
CTCCGCTTATGGGCAATAGCTGXTTCTTCTTTGATGCCTCAGATGATAGTATGGCACAAACTAAGCGGACACTGGTACATACTTCAAAAT
CCCGGTAAAACTGAAAGATCTACTATTCCCCTTGGCAAGTCTGCTATTXTTCTTCAGCAGTGCAAGCCCACTTCTTCTGGCCCGTTGGTC
ATCCACCATTACAAAGGCCTCGTTGAAAGAATCCTCCAGCGCTTGCAGTCCGTGGAGTCCGGGTGTTCTAGAACGTACGCCGACCAGNCN
ATGCATAGACCACTCGAGTCCATTNNNNNNNNNGNNCCTNNCCCCTCCTTCCCC
Edits in Original Sequence 
TTGTTGAACT(5')ATGGGGATTTCTGGTTTCCAAAAATGGGAACCACCCCCTCCAACCCCAATcCTGGGGCCAATTTCTTCCGGAATTA
AAAAAGGGGTTTTTCCCCGATTTTCXGGGCCCTTTTGGTTTaAAAAAATGCCCCTGATTTAACCAAAATTTTTACCGCGAATTTTAACCA
AAATATTGAACGCCTCCCATTGTGCCATTCGGCCTTCCGGGCTGCGCAATTGTTGGGAACGCCGATCGGTGGGGGCCTTTTTcGCTATTA
CGCCAGCTGGCGAAAGGGGAATGTGCTGCAAGGCGATTAAGTTGGGTAACGCCAGGGTTTTCCCAGTCAGGACGTTGTACACCGACGXGC
CAGTGAATTGTAATTCGACTCACTATAGGGCGAATTGGGTACCgGGCCCCCCCTCGAGTAATTTTCTATTTTTTGTTGAACTTAAAACAC
AATGATATATATTCCTCAGGCAATGTGAACATACAAGCGATAGTTCATTTTATTATTCATTCACTTGTTACATACTTGTACAACAGTCAA
AATTATGACATCGTTACXCAGATTTATGTAACAGTTTCTCCTCTAGTTCGCTCTGTTGTGGTTGCAGCTGCCTCCGCGGAAAAAACATTA
GtCTGTTAACTGTTTTCTCCTCCGCTTATGGGCAATAGCTGXTTCTTCTTTGATGCCTCAGATGATAGTATGGCACAAACTAAGCGGACA
CTGGTACATACTTCAAAATCCCGGTAAAACTGAAAGATCTACTATTCCCCTTGGCAAGTCTGCTATTXTTCTTCAGCAGTGCAAGCCCAC
TTCTTCTGGCCCGTTGGTCATCCACCATTACAAAGGCCTCGTTGAAAGAATCCTCCAGCGCTTGCAGTCCGTGGAGTCCGGGTGTTCTAG
AACGTACGCCGACCAGNCNATGCATAGACCACTCGAGTCCATTNNNNNNNNNGNNCCTNNCCCCTCCTTCCCC(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan