ESTScan Details for Unigene SGN-U337158

Score 
77
Direction 
Forward
Predicted Peptide Sequence 
MSGSIYAPSEFDSGNGDSVASTPLSERRHRDMYSLTFDTQPRARFMCSFGGKIVLMPHDRQLRYVGGDTRIVAVNRHTTFAALLGKLSKL
IGYPNINIKYQLPNEELDALITVTTDEDXGEYDGRVRSAYAESEIGSDWPXDVALTILDPEPAAISSILDGSSKREQWFVDALNGGAGPG
LERGDPKDRLLVLEVPDTWXGLDNSHDPARELKFXEEQDNFGGGGYPVPPWFX
Predicted Coding Sequence 
ATGAGTGGGTCTATTTACGCGCCGTCAGAGTTCGACTCCGGCAACGGCGATTCAGTAGCCTCCACACCTCTCTCGGAGCGGCGCCACCGG
GACATGTACTCTCTTACTTTCGATACACAGCCACGTGCCCGTTTCATGTGCAGCTTCGGTGGCAAAATTGTGCTCATGCCACACGACAGG
CAACTTCGTTACGTCGGCGGCGATACTCGAATTGTTGCGGTGAACCGCCACACTACCTTCGCAGCTCTCCTTGGAAAACTCTCCAAACTC
ATCGGATATCCAAACATTAACATCAAGTACCAGCTTCCTAACGAGGAACTGGATGCTTTGATAACCGTCACAACCGATGAAGATXTTGGA
GAATATGATGGAAGAGTACGATCGGCTTACGCAGAATCAGAAATAGGCTCGGATTGGCCTGXTGACGTTGCCCTAACCATTCTGGATCCA
GAGCCAGCXGCTATCAGCTCCATCCTCGACGGCTCATCTAAGCGAGAGCAATGGTTTGTTGACGCTCTCAATGGTGGCGCCGGTCCGGGT
CTGGAGCGTGGCGATCCGAAAGATCGTCTATTGGTTCTTGAAGTTCCGGATACTTGGXTCGGGCTGGACAATTCCCATGACCCGGCCCGC
GAATTGAAATTCXTGGAAGAACAAGATAATTTTGGAGGCGGXGGTTACCCGGTTCCCCCTTGGTTTGXX
Edits in Original Sequence 
GAGCGGCGCCACCGGGACATGTACTCTCTTACTTTCGATACACAGCCACGTGCCCGTTTCATGTGCAGCTTCGGTGGCAAAATTGTGCTC
ATGCCACACGACAGGTCAACTTCGTTACGTCGGCGGCGATACTCGAATTGTTGCGGTGAACCGCCACACTACCTTCG
(5')ATGAGTGGG
TCTATTTACGCGCCGTCAGAGTTCGACTCCGGCAACGGCGATTCAGTAGCCTCCACACCTCTCTCGGAGCGGCGCCACCGGGACATGTAC
TCTCTTACTTTCGATACACAGCCACGTGCCCGTTTCATGTGCAGCTTCGGTGGCAAAATTGTGCTCATGCCACACGACAGGtCAACTTCG
TTACGTCGGCGGCGATACTCGAATTGTTGCGGTGAACCGCCACACTACCTTCGCAGCTCTCCTTGGAAAACTCTCCAAACTCATCGGATA
TCCAAACATTAACATCAAGTACCAGCTTCCTAACGAGGAACTGGATGCTTTGATAACCGTCACAACCGATGAAGATXTTGGAGAATATGA
TGGAAGAGTACGATCGGCTTACGCAGAATCAGAAATAGGCTCGGATTGGCCTGXTGACGTTGCCCTAACCATTCTGGATCCAGAGCCAGC
XGCTATCAGCTCCATCCTCGACGGCTCATCTAAGCGAGAGCAATGGTTTGTTGACGCTCTCAATGGTGGCGCCGGTCCGGGTCTGGAGCG
TgGGCGATCCGAAAGATCGTCTATTGGTTCTTGAAGTTCCGGATACTTGGXTCGGGCTGGACAATTCCCATGACCCGGCCCGCGAATTGA
AATTCXTGGAAGAACAAGATAATTTTGGAGGCGGXGGTTACCCGGTTCCCCCTTGGTTTGXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan