ESTScan Details for Unigene SGN-U337162

Score 
-109
Direction 
Reverse
Predicted Peptide Sequence 
DRSSGGWEPYGKKPAQGGIFSVSGAFGGPIIPNVLPGXYPLDYGGSRITPFEGVDFAAAAETTERRDSVSEEAEEIPIRKPPLPEVGGFI
NAAGSTGFPTGKRAVSATQLMELVQSLGTPGFTRYASGSYVVGNREXDNHFATETAXVHDYAKLEINPLLKGTKVGAXTAVAAAVELVDP
PGLQEFGTRVSNREDDKCWLFPTIGLLFKSVQAGFVDWHLAKLEVQDFSLFSPDPDTFWVYEAVS
Predicted Coding Sequence 
XTTGATCGTTCGTCAGGGGGGTGGGAGCCTTATGGAAAAAAACCCGCCCAAGGGGGCATTTTTTCTGTTTCCGGGGCTTTTGGCGGACCT
ATTATTCCCAATGTGCTTCCCGGCGXTTATCCCCTTGATTATGGGGGTAGCCGTATTACGCCCTTTGAGGGAGTTGATTTCGCTGCTGCA
GCCGAAACGACTGAGCGCAGAGATTCAGTGAGCGAGGAAGCGGAAGAAATCCCAATTCGCAAACCGCCTCTCCCCGAGGTTGGCGGATTC
ATTAATGCAGCTGGCTCGACAGGTTTCCCGACTGGAAAGCGGGCAGTGAGCGCTACGCAATTAATGGAGTTAGTTCAATCATTAGGCACC
CCAGGCTTTACACGTTATGCTTCCGGGTCGTATGTTGTGGGGAATCGTGAGCXGGATAACCATTTCGCCACGGAAACAGCTXATGTCCAT
GATTACGCCAAGCTCGAAATTAACCCTCTTCTAAAGGGAACTAAAGTTGGAGCTXCCACCGCGGTGGCGGCCGCTGTAGAACTAGTGGAT
CCCCCXGGGCTGCAGGAATTCGGCACGAGGGTTTCGAATAGGGAAGATGACAAATGTTGGCTTTTTCCGACGATTGGGCTGCTATTTAAG
TCTGTTCAAGCTGGATTTGTTGATTGGCATCTAGCAAAGTTAGAAGTTCAAGATTTTTCTCTGTTCAGTCCAGATCCCGATACGTTTTGG
GTGTATGAAGCTGTTTCTTGA
Edits in Original Sequence 
(5')XTTGATCGTTCGTCAGGGGGGTGGGAGCCTTATGGAAAAAAACCCGCCCAAGGGGGCATTTTTTCTGTTTCCGGGGCTTTTGGCGG
ACCTATTATTCCCAATGTGCTTCCCGGCGXTTATCCCCTTGATTATGGGGGTAGCCGTATTACGCCCTTTGAGGGAGTTGATTTCGCTcG
CTGCAGCCGAAACGACTGAGCGCAGAGATTCAGTGAGCGAGGAAGCGGAAGAAATCCCAATTCGCAAACCGCCTCTCCCCGAGcGTTGGC
GGATTCATTAATGCAGCTGGCTCGACAGGTTTCCCGACTGGAAAGCGGGCAGTGAGCGCTACGCAATTAATGtGAGTTAGTTCAATCATT
AGGCACCCCAGGCTTTACACGTTATGCTTCCGGGTCGTATGTTGTGGGGAATCGTGAGCXGGATAACCATTTCGCCACGGAAACAGCTXA
TGTCCATGATTACGCCAAGCTCGAAATTAACCCTCTTCTAAAGGGAACTAAAGTTGGAGCTXCCACCGCGGTGGCGGCCGCTGTAGAACT
AGTGGATCCCCCXGGGCTGCAGGAATTCGGCACGAGGGTTTCGAATAGGGAAGATGACAAATGTTGGCTTTTTCCGACGATTGGGCTGCT
ATTTAAGTCTGTTCAAGCTGGATTTGTTGATTGGCATCTAGCAAAGTTAGAAGTTCAAGATTTTTCTCTGTTCAGTCCAGATCCCGATAC
GTTTTGGGTGTATGAAGCTGTTTCTTGA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan