ESTScan Details for Unigene SGN-U337190

Score 
207
Direction 
Forward
Predicted Peptide Sequence 
MGTHKGVVLDSCDVVGTFGYLAPEYFMYGKVSDKIDVYSFGVVLLELLSGRKAIGFETPSGQXKFGYVGKHHLYFDMNYYFHSSEIFXKL
IITFQAKPKLESRNYNAILDENLNVNIEDDQVQRMILAARLCLTQAARLRPNISQVTITTFTLQYNLIITLGFXYLTLHEIYDICEKSNV
MGEAMHF
Predicted Coding Sequence 
ATGGGGACCCACAAAGGCGTCGTTCTTGACTCATGTGATGTGGTAGGAACATTTGGTTATCTAGCACCAGAGTATTTTATGTATGGGAAA
GTTAGCGATAAGATTGATGTCTACTCCTTTGGAGTGGTTTTGCTGGAACTATTATCAGGGAGAAAAGCTATTGGCTTTGAGACTCCCAGT
GGTCAAGAXAAGTTTGGTTATGTGGGTAAGCATCATCTCTACTTTGACATGAATTACTACTTCCATTCATCCGAAATTTTTAAXAAATTA
ATTATTACTTTCCAGGCAAAACCTAAGTTAGAAAGCAGGAATTACAATGCCATTCTGGATGAGAACTTGAATGTAAATATTGAAGATGAT
CAAGTCCAAAGAATGATTCTTGCAGCAAGACTCTGTCTTACACAGGCAGCACGACTACGTCCTAACATAAGCCAGGTAACTATAACAACA
TTTACTTTGCAATATAATCTCATTATAACTCTTGGTTTTCXGTATTTAACTCTGCATGAGATATACGATATTTGTGAAAAATCAAACGTT
ATGGGAGAAGCTATGCACTTTTAA
Edits in Original Sequence 
AGGAATTCTTGTTTGCAGCTATCCGATTTTGGGTTAGCGATATGGGGACCCACAAAGGCGTCGTTCTTGACTCATAGTGATGTGGTAGGA
ACATTTGGTTAT
(5')ATGGGGACCCACAAAGGCGTCGTTCTTGACTCATaGTGATGTGGTAGGAACATTTGGTTATCTAGCACCAGAGT
ATTTTATGTATGGGAAAGTTAGCGATAAGATTGATGTCTACTCCTTTGGAGTGGTTTTGCTGGAACTATTATCAGGGAGAAAAGCTATTG
GCTTTGAGACTCCCAGTGGTCAAGAXAAGTTTGGTTATGTGGGTAAGCATCATCTCTACTTTGACATGAATTACTACTTCCATTCATCCG
AAATTTTTAAXAAATTAATTATTACTTTCCAGGCAAAACCTAAGTTAGAAAGCAGGAATTACAATGCCATTCTGGATGAGAACTTGAATG
TAAATATTGAAGATGATCAAGTCCAAAGAATGATTCTTGCAGCAAGACTCTGTCTTACACAGGCAGCACGACTACGTCCTAACATAAGCC
AGGTAACTATAACAACATTTACTTTGCAATATAATCTCATTATAACTCTTGGTTTTCXGTATTTAACTCTGCATGAGATATACGATATTT
GTGAAAAATCAAACGTTATGGGAGAAGCTATGCACTTTTAA(3')TTCCAAAAACACATCTGCACCTATGTCGGATCCTATATATTATTG
TTTTATAACTCAAGCATGTTGTTATTTACGTAGATCCTAAAGATGCTGAAGGGGGAGAAAGATGGGAATGAAGAAGTAATTGCTNAGAAA
CAACATACGGA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan