Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U337192

Score 
229
Direction 
Reverse
Predicted Peptide Sequence 
MGLSQDPTPTKAGVFCVFLVNTAISISIVKEMVRSILHVIGIPIASWGDYSIEGSLDSFXMSQKPLKVIYGGIQKPYPRNSL
Predicted Coding Sequence 
ATGGGGCTTTCCCAAGATCCAACTCCAACAAAAGCAGGAGTGTTTTGTGTTTTTTTAGTGAACACAGCCATATCCATTTCCATTGTCAAG
GAGATGGTCCGATCGATCCTTCATGTGATTGGCATCCCCATTGCATCATGGGGCGATTATTCCATCGAAGGCTCCTTGGACTCGTTTGAX
ATGTCGCAGAAGCCCCTCAAAGTCATATATGGAGGAATTCAAAAGCCATACCCCCGCAATTCGTTATGA
Edits in Original Sequence 
GCATCATGGGGCGATTATTCCATCGAAGGCTCCTTGGACTCGTTTGAATGTCGCAGAAGCCCCTCAAAGTCATATATGGAGGAATTCAAA
AGCCATACCCCCG
(5')ATGGGGCTTTCCCAAGATCCAACTCCAACAAAAGCAGGAGTGTTTTGTGTTTTTTTAGTGAACACAGCCATAT
CCATTTCCATTGTCAAGGAGATGGTCCGATCGATCCTTCATGTGATTGGCATCCCCATTGCATCATGGGGCGATTATTCCATCGAAGGCT
CCTTGGACTCGTTTGAXATGTCGCAGAAGCCCCTCAAAGTCATATATGGAGGAATTCAAAAGCCATACCCCCGCAATTCGTTATGA(3')
GCCCTACTATACATTTTGAGGACAGCTTAGTAGGGGACAAGCAAAGGTTGATTTTTGACATTGGGGAGTTTTGTATTTGTAAAGCTTGGG
GTCCTTTCAAAATGACGGGTTTTTTTTCTGCGACCAAAAATTCATACATTTGGGGACATAAAATATGGAAAATTTTGGTTTGATGTTTTC
CCTCCC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan