ESTScan Details for Unigene SGN-U337197

Score 
-129
Direction 
Forward
Predicted Peptide Sequence 
MDTDAVALWQKPRNEPHDSLHETSGSPLYAKYITSIASAEFLQPGGSTSSRAAATAVELQLLFPLVRVNFELGVIMVIAVSCVKLLSLTI
PHNIRAGSINVKPGVPNDELTHINCVALTARFPVGKPVVPAAINESANAAGRGGLRIGRSSASSLTXLAALGRSAAAAVSTHSKAGIRLS
PESGDNPGKNSGAKRAAKGPGTLKKGAVAGRFFPKAPAPPEKLPKKSNPPNPKVAQNPDGDFYKITRX
Predicted Coding Sequence 
ATGGACACAGATGCTGTAGCTTTGTGGCAAAAACCTCGAAATGAACCACATGATTCACTCCATGAAACTTCTGGATCTCCTTTATATGCT
AAATACATCACCTCCATCGCCTCGGCCGAATTCCTGCAGCCCGGGGGATCCACTAGTTCTAGAGCGGCCGCCACCGCGGTGGAGCTCCAG
CTTTTGTTCCCTTTAGTGAGGGTTAATTTCGAGCTTGGCGTAATCATGGTCATAGCTGTTTCCTGTGTGAAATTGTTATCCCTCACAATT
CCACACAACATACGAGCCGGAAGCATAAATGTAAAGCCTGGGGTGCCTAATGATGAGCTAACTCACATTAATTGCGTTGCGCTCACTGCC
CGCTTTCCAGTCGGGAAACCTGTCGTGCCAGCTGCXATTAATGAATCGGCCAACGCXGCGGGGAGAGGCGGTTTGCGTATTGGGCGCTCT
TCCGCTTCCTCGCTCACTGAXCTCGCTGCGCTCGGTCGTTCGGCTGCGGCGGCGGTATCAACTCACTCAAAGGCGGGAATACGGTTATCC
CCAGAATCAGGGGATAACCCAGGAAAAAACAGTGGAGCCAAAAGGGCAGCAAAAGGCCCAGGAACCCTAAAAAAGGGCGCCGTTGCTGGG
CGTTTTTTCCCTAAGGCTCCCGCCCCCCCGGAGAAGCTTCCCAAAAAATCGAACCCCCCAAATCCAAAGGTGGCGCAAAACCCCGACGGG
GACTTTTATAAAATAACCAGGGXX
Edits in Original Sequence 
TTTTTTTTTTTTTTTTTTGAAGAACACAAAATTTACCAGCCATTATATTTCATGACAAACAACATCCTTTTCATGAAGAACCTTTAAAAG
AAAAAGTAAAGCAACATCCTTGATTGGACCTAATTATCTAATTTATTAGCATTAGCCGGGTACATGATATAGTAAAACCAACACCAACAA
CCAAAACTAAAGAGGGATCAGTTTCAAAATCTCAATAGTTAGCAATCTCAATTCCCCCTTTGTTGTTGTACGATCCAACTGGGGCATCAT
ACTTGCTAAAAAGCCGATAAGACGAAAGCAACGAAAGCCCTGCATAACAAAGGCTTACTATAAAAGTAATGGACACAGATGCTGTAGCTT
TGTGGCAAAA
(5')ATGGACACAGATGCTGTAGCTTTGTGGCAAAAACCTCGAAATGAACCACATGATTCACTCCATGAAACTTCTGGAT
CTCCTTTATATGCTAAATACATCACCTCCATCGCCTCGtGCCGAATTCCTGCAGCCCGGGGGATCCACTAGTTCTAGAGCGGCCGCCACC
GCGGTGGAGCTCCAGCTTTTGTTCCCTTTAGTGAGGGTTAATTTCGAGCTTGGCGTAATCATGGTCATAGCTGTTTCCTGTGTGAAATTG
TTATCCgCTCACAATTCCACACAACATACGAGCCGGAAGCATAAAgTGTAAAGCCTGGGGTGCCTAATGAgTGAGCTAACTCACATTAAT
TGCGTTGCGCTCACTGCCCGCTTTCCAGTCGGGAAACCTGTCGTGCCAGCTGCXATTAATGAATCGGCCAACGCXGCGGGGAGAGGCGGT
TTGCGTATTGGGCGCTCTTCCGCTTCCTCGCTCACTGAXCTCGCTGCGCTCGGTCGTTCGGCTGCGGCGaGCGGTATCAACTCACTCAAA
GGCGGGAATACGGTTATCCCCAGAATCAGGGGATAACCCAGGAAAAAACAtGTGGAGCCAAAAGGGCAGCAAAAGGCCCAGGAACCCTAA
AAAAGGGCGCCGTTGCTGGGCGTTTTTTCCCTAAGGCTCCCGCCCCCCCGGAcGAAGCTTCCCAAAAAATCGAACCCCCCAAATCCAAAG
GTGGCGCAAAACCCCGACGGGGACTTTTATAAAATAACCAGGGXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan