ESTScan Details for Unigene SGN-U337206

Score 
574
Direction 
Forward
Predicted Peptide Sequence 
VIEXXXXFENPGLPAVAAAXRTSGSPGLQAHHQYNHTLDHDIDINEDTFEFKFDYDSSINIIGDDEVVTKDENKKKILLNLDYEGVLKAW
PFTISPRTPLVSHGGRITIGVTNAANRQSETATVQXAAGIEAAEASTDLMKANIARKESAEDTHAPVEEKRLTTWGTEVPDDLVLDQQKL
AEALKKEDEKRRKXRDERKRKSNGKYNDEGSPEEMEAYRMKKGLHDDXREGTFALSYIYRRGGALAPL
Predicted Coding Sequence 
GTGATCGAGNGGNCNTNNNGGTTTGAAAACCCTGGACTACCTGCGGTGGCGGCCGCTXCTAGAACTAGTGGATCCCCCGGGCTGCAGGCA
CATCATCAATATAATCATACTCTTGATCATGATATTGATATTAACGAAGACACCTTTGAGTTCAAATTCGATTACGATTCGTCGATAAAT
ATTATCGGAGACGATGAAGTAGTGACGAAGGATGAAAATAAAAAGAAGATTTTATTAAATCTTGACTATGAAGGTGTATTAAAAGCATGG
CCTTTCACCATTAGTCCAAGGACACCTTTGGTCAGCCATGGTGGAAGGATCACCATTGGGGTTACAAATGCTGCAAACAGACAATCAGAA
ACAGCTACTGTACAGGXTGCTGCTGGAATTGAAGCAGCTGAGGCTTCTACTGATCTTATGAAGGCCAATATTGCTCGCAAGGAGTCTGCT
GAAGATACACATGCGCCGGTTGAGGAGAAGAGGCTCACTACTTGGGGAACTGAAGTTCCTGACGATTTGGTTCTGGACCAGCAAAAGCTG
GCTGAAGCTCTTAAAAAGGAGGATGAAAAGAGGAGAAAANAGAGGGATGAAAGGAAAAGGAAATCCAACGGGAAATACAATGACGAGGGT
TCACCGGAAGAAATGGAGGCTTACAGAATGAAAAAGGGCCTTCATGACGATXCCCGTGAGGGGACTTTTGCCCTGAGTTATATATACAGA
AGGGGGGGAGCCCTGGCCCCTCTTTAG
Edits in Original Sequence 
(5')GTGATCGAGNGGNCNTNNNGGTTTGAAAACCCTGGACTACCTGCGGTGGCGGCCGCTXCTAGAACTAGTGGATCCCCCGGGCTGCA
GGCACgATCATCAATATAATCATACTCTTGATCATGATATTGATATTAACGAAGACACCTTTGAGTTCAAATTCGATTACGATTCGTCGA
TAAATATTATCGGAGACGATGAAGTAGTGACGAAGGATGAAAATAAAAAGAAGATTTTATTAAATCTTGACTATGAAGGTGTATTAAAAG
CATGGCCTTTCACCATTAGTCCAAGGACACCTTTGGTCAGCCATGGTGGAAGGATCACCATTGGGGTTACAAATGCTGCAAACAGACAAT
CAGAAACAGCTACTGTACAGGXTGCTGCTGGAATTGAAGCAGCTGAGGCTTCTACTGATCTTATGAAGGCCAATATTGCTCGCAAGGAGT
CTGCTGAAGATACACATGCGCCGGTTGAGGAGAAGAGGCTCACTACTTGGGGAACTGAAGTTCCTGACGATTTGGTTCTGGACCAGCAAA
AGCTGGCTGAAGCTCTTAAAAAGGAGGATGAAAAGAGGAGAAAANAGAGGGATGAAAGGAAAAGGAAATCCAACGGGAAATACAATGACG
AGGGTTaCACCGGAAGAAATGGAGGCTTACAGAATGAAAAAGGGCCTTCATGACGATXCCCGTGAGGGGACTTTTGCCCTGAGTTATATA
TACAGAAGGGGGGGAGCCCTGGCCCCTCTTTAG(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan