ESTScan Details for Unigene SGN-U337310

Score 
-237
Direction 
Reverse
Predicted Peptide Sequence 
MEKPPATAAFLVSRAFCWPLVHMFFPALSPDSVDNRITPLSELIPLAAAERPSAAESVSEEAEERPIRKPPLPAVGRFINAAGTTGFPTG
KRAVSATQLMELAHSLGTPGFTLYASGRMLCGIVTDNNFTQETAMTMITPSSKLTLTKGNKSWSSPAVAAALELVDPRAAGIRHEGELEF
VEIKAINWRTGANSTNEKYDXFPDWTACEDLQCSVQIAIYNFLSNSVHIYKFLGYSFYLTNFVPGASASLLNFESLDIGCEIVEEGLALT
FRHE
Predicted Coding Sequence 
ATGGAAAAACCGCCCGCAACGGCGGCTTTTTTGGTTTCCCGGGCTTTTTGTTGGCCTTTGGTTCACATGTTTTTTCCTGCGTTATCCCCT
GATTCTGTGGATAACCGTATTACCCCTTTGAGTGAGCTGATACCGCTCGCCGCAGCCGAACGACCGAGCGCAGCXGAGTCAGTGAGCGAG
GAAGCGGAAGAGCGCCCAATACGCAAACCGCCTCTCCCCGCCGTTGGCCGATTCATTAATGCAGCTGGCACGACAGGTTTCCCGACTGGA
AAGCGGGCAGTGAGCGCAACGCAATTAATGGAGTTAGCTCACTCATTAGGCACCCCAGGCTTTACACTTTATGCTTCCGGCCGTATGTTG
TGTGGAATTGTGACGGATAACAATTTCACACAGGAAACAGCTATGACCATGATTACGCCAAGCTCGAAATTAACCCTCACTAAAGGGAAC
AAAAGCTGGAGCTCCCCCGCGGTGGCGGCCGCTCTAGAACTAGTGGATCCCCGGGCTGCAGGAATTCGGCACGAGGGAGAGCTCGAATTC
GTGGAAATAAAGGCTATTAATTGGAGGACTGGCGCAAATTCCACAAATGAGAAGTACGATXATTTTCCAGACTGGACTGCATGTGAAGAC
TTGCAGTGTTCTGTACAAATTGCAATTTACAATTTTCTCAGCAACAGTGTCCACATATACAAGTTTCTTGGATACTCATTTTACTTGACA
AACTTTGTACCTGGTGCTTCGGCCTCCCTTCTTAATTTTGAATCCCTTGATATTGGATGTGAAATTGTGGAAGAGGGTTTAGCTCTCACT
TTTCGTCATGAATGA
Edits in Original Sequence 
GAGAGCTCGAATTCGTGGAAATAAAGGCTATTAATTGGTAGGACTGGCGCAAATTCCACAAATGAGAAGTACGATATTTTCCAGACTGG
(5')ATGGAAAAACCGCCCGCAACGGCGGCTTTTTTaGGTTTCCCGGGCTTTTTGTTGGCCTTTGGTTCACATGTTTTTTCCTGCGTTATC
CCCTGATTCTGTGGATAACCGTATTACCgCCTTTGAGTGAGCTGATACCGCTCGCCGCAGCCGAACGACCGAGCGCAGCXGAGTCAGTGA
GCGAGGAAGCGGAAGAGCGCCCAATACGCAAACCGCCTCTCCCCGCgCGTTGGCCGATTCATTAATGCAGCTGGCACGACAGGTTTCCCG
ACTGGAAAGCGGGCAGTGAGCGCAACGCAATTAATGtGAGTTAGCTCACTCATTAGGCACCCCAGGCTTTACACTTTATGCTTCCGGCtC
GTATGTTGTGTGGAATTGTGAgCGGATAACAATTTCACACAGGAAACAGCTATGACCATGATTACGCCAAGCTCGAAATTAACCCTCACT
AAAGGGAACAAAAGCTGGAGCTCCCCCGCGGTGGCGGCCGCTCTAGAACTAGTGGATcCCCCGGGCTGCAGGAATTCGGCACGAGGGAGA
GCTCGAATTCGTGGAAATAAAGGCTATTAATTGGtAGGACTGGCGCAAATTCCACAAATGAGAAGTACGATXATTTTCCAGACTGGACTG
CATGTGAAGACTTGCAGTGTTCTGTACAAATTGCAATTTACAATTTTCTCAGCAACAGTGTCgCACATATACAAGTTTCTTGGATACTCA
TTTTACTTGACAAACTTTGTACCTGGTGCTTCGGCCTCCCTTCTTAATTTTGAATCCCgTTGATATTGGATGTGAAATTGTGGAAGAGGG
TTTAGCTCTCACTTTTCGTCATGAATGA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan