ESTScan Details for Unigene SGN-U337380

Score 
-215
Direction 
Reverse
Predicted Peptide Sequence 
LIGGGFLVMFVRGGEPREKRQQRGPFLVSCPLGGLWSTVVFWRYPGDSVDNRIAALSELIPFAAAERPAQRVSEEEAEERPIRKLLLPAV
GRFINAAGTTGFPTGKRAVSATQLMELGHSLGTPGFTLYASGRMLCGIVTDNNFTQEPAMAMIMPSSKLTLIKGXQKMELLRGGGRSRIS
GSPGLQELGTGPSAGSIGSWCMALYGFDI
Predicted Coding Sequence 
XTTTTGATTGGAGGTGGATTTTTAGTGATGTTTGTTCGGGGGGGGGAGCCTAGGGAAAAACGCCAGCAAAGGGGGCCTTTTTTGGTTTCT
TGCCCTTTGGGTGGCCTTTGGTCAACAGTTGTTTTCTGGCGTTATCCCGGXGATTCTGTGGATAACCGTATTGCGGCCTTGAGTGAGTTG
ATACCGTTCGCCGCAGCTGAACGACCGGCGCAGAGAGTCAGTGAGGAGGAAGCGGAAGAGCGCCCAATACGCAAACTGCTTCTCCCCGCC
GTTGGCAGATTCATTAATGCAGCTGGCACGACAGGTTTCCCGACTGGAAAGCGGGCAGTGAGCGCAACGCAATTAATGGAGTTAGGTCAC
TCATTAGGCACCCCAGGCTTTACACTTTATGCTTCCGGCCGTATGTTGTGTGGAATTGTGACGGATAACAATTTCACACAGGAACCAGCT
ATGGCCATGATTATGCCAAGCTCGAAATTAACCCTCATTAAAGGGAAXCAAAAGATGGAGCTCCTCCGCGGTGGCGGCCGCTCTAGAATT
AGTGGATCCCCGGGGCTGCAGGAATTAGGCACGGGGCCATCTGCTGGTAGCATTGGGTCATGGTGTATGGCCTTATATGGTTTTGATATC
TGA
Edits in Original Sequence 
(5')XTTTTGATTGGAgGGTGGATTTTTAGTGATGTTTGTTCGGGGGGGGGAGCCTAGGGAAAAACGCCAGCAAAGGGGGCCTTTTTTGG
TTTCTTGCCCTTTGGGTGGCCTTTGGTCAACAGTTGTTTTCTGGCGTTATCCCGGXGATTCTGTGGATAACCGTATTGCGGCCTTGAGTG
AGTTGATACCGTTCGCCGCAGCTGAACGACCGaGCGCAGAGAGTCAGTGAGcGAGGAAGCGGAAGAGCGCCCAATACGCAAACTGCTTCT
CCCCGCgCGTTGGCAGATTCATTAATGCAGCTGGCACGACAGGTTTCCCGACTGGAAAGCGGGCAGTGAGCGCAACGCAATTAATGtGAG
TTAGGTCACTCATTAGGCACCCCAGGCTTTACACTTTATGCTTCCGGCtCGTATGTTGTGTGGAATTGTGAgCGGATAACAATTTCACAC
AGGAACCAGCTATGGCCATGATTATGCCAAGCTCGAAATTAACCCTCATTAAAGGGAAXCAAAAGATGGAGCTCCTCCGCGGTGGCGGCC
GCTCTAGAATTAGTGGATCCCCGGGGCTGCAGGAATTAGGCACGaGGGCCATCTGCTGGTAGCATTGGGTCATGGTGTATGGCCTTATAT
GGTTTTGATATCTGA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan