ESTScan Details for Unigene SGN-U337384

Score 
478
Direction 
Forward
Predicted Peptide Sequence 
MAKLKTDSPLSRRIVLSFLRFLDSVEPAAGVDYEGLEVAKQCLSEAFKIDPSSHASSSDSLVDIFSSGEAVDQSQRSVDLRHDVSSSDAP
CTSSRQKAEDRTKEAHSFVSLNARLKHT
Predicted Coding Sequence 
ATGGCGAAGCTGAAGACGGATTCTCCTCTCTCGCGTCGCATAGTTCTCTCCTTCTTGCGCTTCCTTGATTCTGTGGAACCTGCTGCAGGA
GTTGATTATGAAGGACTTGAGGTTGCTAAGCAATGTCTATCAGAGGCTTTTAAGATTGATCCTTCATCTCATGCCTCAAGTTCAGACTCA
TTAGTGGACATATTCAGTTCAGGGGAAGCAGTTGACCAAAGCCAAAGAAGTGTAGATCTTAGGCATGATGTATCTTCATCAGATGCTCCT
TGTACATCTTCAAGGCAGAAGGCCGAAGATAGGACAAAAGAAGCTCACAGTTTTGTGTCATTAAATGCTCGCTTGAAGCACACTTAA
Edits in Original Sequence 
GCGGTGGTCTCCTCCGTCAATGGCGAAGCTGAAGACGGATTCTCCTCTCTCGCGTCGCATAGTTCTCTCCTTCTTG(5')ATGGCGAAGC
TGAAGACGGATTCTCCTCTCTCGCGTCGCATAGTTCTCTCCTTCTTGCGCTTCCTTGATTCTGTGGAACCTGCTGCAGGAGTTGATTATG
AAGGACTTGAGGTTGCTAAGCAATGTCTATCAGAGGCTTTTAAGATTGATCCTTCATCTCATGCCTCAAGTTCAGACTCATTAGTGGACA
TATTCAGTTCAGGGGAAGCAGTTGACCAAAGCCAAAGAAGTGTAGATCTTAGGCATGATGTATCTTCATCAGATGCTCCTTGTACATCTT
CAAGGCAGAAGGCCGAAGATAGGACAAAAGAAGCTCACAGTTTTGTGTCATTAAATGCTCGCTTGAAGCACACTTAA(3')TGTGCAAGC
ACCAAGCCACTTAGACCTACACCTCATCACCACGGGTCTGTCTTTAAGAGGGCAAATCTTGGCAATTAATATAGTTGGCAAAGCAATATA
GTTTTTGTTAACAAAACGTTATTAATGAACTTGTTAGTGATCGGGATCAAGAAACTAGAGAACTAATAAAGCACTGCTAACTAACTTTTT
TTTTTTAAAAAAATGTACATGTTTGCATCCAATTCTTAAGTTTAATTTGGTTCATGTACTTTTTGCATCTATATTTTGCCTAGTTCCAAA
AA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan