Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U337420

Score 
389
Direction 
Forward
Predicted Peptide Sequence 
MTTEQLLLSIDPLDLKFPFELNKPVSTAFQLINKTDNHVAFKVKTTNPRKYTVRPNSGIVLPRSRSNVTVTMQPQMELPPVQQVRGNDVE
ECKLKVIYVSPPRKPSPVPEDSEEGTSPTASDSDLQEDSEPQDNSIKARDLILRLMEERDSILRENAKLXPRPGI
Predicted Coding Sequence 
ATGACAACTGAACAACTACTTCTAAGTATCGATCCTTTGGACCTCAAATTTCCATTTGAACTCAACAAGCCAGTTTCGACCGCTTTTCAA
CTCATCAATAAGACTGATAATCATGTTGCTTTCAAGGTAAAGACGACCAATCCCAGAAAGTATACTGTTAGGCCGAACAGTGGAATTGTT
CTCCCACGATCAAGGTCCAATGTTACAGTTACGATGCAACCTCAAATGGAGTTACCTCCAGTTCAACAAGTCCGGGGAAATGATGTTGAG
GAATGCAAACTAAAAGTTATTTATGTCTCACCACCGCGAAAACCATCACCAGTCCCTGAAGATTCTGAGGAAGGAACTTCACCAACAGCT
TCTGACAGTGATTTACAAGAAGACAGTGAGCCTCAGGACAACTCCATTAAGGCCAGAGATCTCATTTTGAGGTTGATGGAAGAGAGAGAC
TCCATTCTTCGAGAAAATGCTAAACTCAXGCCGAGACCTGGTATTTGA
Edits in Original Sequence 
GCGCAAACTTATAAAATTCATGTTCAAATTCGTCTCTTGAGAATTGAGAATTCAGAAATTTGTTTGATTTTGAAGATGACAACTGAACAA
CTACTTCTAAGTATCGATCCTTTGGACCTCAAATTTCCATTTGAACTCAACAAGCCAGTTTCGACCG
(5')ATGACAACTGAACAACTAC
TTCTAAGTATCGATCCTTTGGACCTCAAATTTCCATTTGAACTCAACAAGCCAGTTTCGACCGCTTTTCAACTCATCAATAAGACTGATA
ATCATGTTGCTTTCAAGGTAAAGACGACCAATCCCAGAAAGTATACTGTTAGGCCGAACAGTGGAATTGTTCTCCCACGATCAAGGTCCA
ATGTTACAGTTACGATGCAACCTCAAATGGAGTTACCTCCAGTTCAACAAGTCCGGGGtAAATGATGTTGAGGAATGCAAACTAAAAGTT
ATTTATGTCTCACCACCGCGAAAACCATCACCAGTCCCTGAAGATTCTGAGGAAGGAACTTCACCAACAGCTTCTGACAGTGATTTACAA
GAAGACAGTGAGCCTCAGGACAACTCCATTAAGGCCAGAGATCTCATTTTGAGGTTGATGGAAGAGAGAGACTCCATTCTTCGAGAAAAT
GCTAAACTCAXGCCGAGACCTGGTATTTGA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan